SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0023
         (852 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_06_0383 + 22965599-22966090                                         33   0.22 
04_03_0534 - 16845094-16845511,16846180-16846211                       29   3.6  
11_01_0446 + 3462820-3464265                                           28   8.2  
03_05_0327 - 23154014-23154942,23155169-23155316,23155606-231566...    28   8.2  

>11_06_0383 + 22965599-22966090
          Length = 163

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 19/61 (31%), Positives = 34/61 (55%)
 Frame = -1

Query: 261 HLRCRCLWASGNHLTPGGL*ARPPIYAIKKNILTTRSLVLMGHSGVLGILRCQEHSSRAA 82
           H RC C+  S + L P  +       A++ ++ ++ +LV++ HSG+L +LR      +AA
Sbjct: 55  HKRCSCVVPSDHSLVPLVV-----FIAVRVSMPSSSALVIVSHSGLLRLLRASSPHLQAA 109

Query: 81  T 79
           T
Sbjct: 110 T 110


>04_03_0534 - 16845094-16845511,16846180-16846211
          Length = 149

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 12/26 (46%), Positives = 13/26 (50%)
 Frame = -3

Query: 241 MGFG*PLNTRWAVSTSTHLCYKKKHL 164
           MG G P   RW     TH  YK+ HL
Sbjct: 1   MGVGAPATKRWYFKEKTHPAYKETHL 26


>11_01_0446 + 3462820-3464265
          Length = 481

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +1

Query: 364 CLFAVVVIRGAWS-IREIFIQLRLLDSCCRWYLLQGRKMTYIHYIR 498
           C+ A++VIR  W  I  +F Q   +   C +  L+GR+  +I  +R
Sbjct: 387 CIIAILVIRELWEIIVHVFSQWTNVLIICSYIRLRGRQGCWIQGLR 432


>03_05_0327 -
           23154014-23154942,23155169-23155316,23155606-23156622,
           23156753-23157217,23160258-23161247
          Length = 1182

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 13/26 (50%), Positives = 14/26 (53%)
 Frame = +1

Query: 85  GSTTVLLATQNAKNARMPHEHK*PSG 162
           GST  L   QN K+AR  H H  P G
Sbjct: 849 GSTNSLKLKQNKKSARQKHHHGVPEG 874


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,836,648
Number of Sequences: 37544
Number of extensions: 452836
Number of successful extensions: 832
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 817
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 832
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2373961368
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).