SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0021
         (602 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_0184 - 27282021-27282313,27284238-27285374,27285524-27285617     32   0.30 
07_02_0023 - 11918735-11918827,11919139-11919231,11919320-119194...    29   2.1  
01_01_0832 - 6500139-6500333,6500610-6500875,6501494-6501815,650...    29   2.8  
12_02_1063 - 25769821-25770365,25770513-25771010,25771394-25771406     29   3.7  
07_01_0371 - 2754176-2754368,2754474-2754571,2755516-2755611           29   3.7  
05_05_0251 + 23616546-23617760                                         29   3.7  
07_03_0706 + 20850634-20850830,20851401-20851576,20851706-20852253     28   5.0  
11_06_0563 - 25018219-25018658,25020381-25020459                       28   6.5  
08_01_0514 + 4481383-4481903,4482532-4484590,4485038-4485107,448...    28   6.5  
10_08_0614 - 19238064-19238132,19238381-19238407,19238436-192385...    27   8.7  
10_01_0079 - 1027655-1027863,1028416-1028619,1028858-1029485           27   8.7  
10_01_0074 + 977173-977309,978271-978351,978444-978459                 27   8.7  
05_05_0044 - 21819193-21819418,21819531-21820759                       27   8.7  
01_06_1368 - 36715630-36715698,36715835-36716284                       27   8.7  
01_01_1013 - 8015552-8015613,8016898-8018035                           27   8.7  

>01_06_0184 - 27282021-27282313,27284238-27285374,27285524-27285617
          Length = 507

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 4/56 (7%)
 Frame = +2

Query: 161 ESSKFQQMQDEMSRFEAEI-SGGTGRAVIGSGTWDA---VQARLERVAPMQAPPEP 316
           +++ F   Q+  SR + ++ SGGTGRA +G G   A     A  E VAP   PP P
Sbjct: 85  DANVFYWFQNRKSRSKNKLRSGGTGRAGLGLGGNRASAPAAAHREAVAPSFTPPPP 140


>07_02_0023 -
           11918735-11918827,11919139-11919231,11919320-11919484,
           11920234-11920327,11921012-11921136,11921228-11921313,
           11921786-11921864,11923777-11923857,11924153-11924260,
           11924870-11924994,11925110-11925530
          Length = 489

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +2

Query: 161 ESSKFQQMQDEMSRFE-AEISGGTGRAVIGSGTWDAVQARLERVAPMQAPPE 313
           +SSK ++ + ++ + E AE  GG   AV G G+ DA  A L   A    PP+
Sbjct: 53  KSSKKKRAKGDLGQGEEAENGGGKVVAVTGKGSADAKYAPLSSFAATALPPQ 104


>01_01_0832 -
           6500139-6500333,6500610-6500875,6501494-6501815,
           6501915-6502156,6502229-6502457,6503020-6503184,
           6503279-6503605,6504150-6504191,6504333-6504400,
           6504748-6504934,6506249-6506311,6506748-6506790,
           6506919-6507019,6507110-6507184,6507359-6507445,
           6507593-6507682,6507906-6507992,6508585-6508783,
           6509113-6509177,6509502-6509606,6509726-6509871,
           6510100-6510224,6510335-6510437,6510482-6510596,
           6510734-6510869,6511298-6511387,6511484-6511578,
           6511698-6511763,6511868-6511936,6512034-6512147,
           6512241-6512448,6512545-6512600,6512818-6513552
          Length = 1671

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 13/34 (38%), Positives = 17/34 (50%)
 Frame = -3

Query: 321 GLGSGGACIGATRSRRACTASHVPDPITARPVPP 220
           G GSG A + A R R     S   D + + P+PP
Sbjct: 36  GEGSGAAVVPAKRRRERVVPSRFRDSVVSLPLPP 69


>12_02_1063 - 25769821-25770365,25770513-25771010,25771394-25771406
          Length = 351

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = -3

Query: 342 SYGAMIEGLGSGGACIGATRSRRACTASHVPDPITARPVP 223
           S GAM  G  +GG  +GAT  R+   ++  P P  ARP P
Sbjct: 90  SLGAMAAGTDNGG--LGATARRKRSASARSPPP--ARPPP 125


>07_01_0371 - 2754176-2754368,2754474-2754571,2755516-2755611
          Length = 128

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%)
 Frame = -3

Query: 336 GAMIEGLGSGG-ACIGATRSRRACTASHVPDPITARP 229
           G++  G G GG AC   TRS R     H  +PI   P
Sbjct: 84  GSVFAGFGLGGLACAWYTRSYRKALKEHFDNPIVWMP 120


>05_05_0251 + 23616546-23617760
          Length = 404

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 11/17 (64%), Positives = 12/17 (70%)
 Frame = +2

Query: 287 VAPMQAPPEPSPSIMAP 337
           VAP Q PP P PSI+ P
Sbjct: 41  VAPQQPPPPPLPSILVP 57


>07_03_0706 + 20850634-20850830,20851401-20851576,20851706-20852253
          Length = 306

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 7/61 (11%)
 Frame = +2

Query: 161 ESSKFQQMQDEMSRFEAEI-SGGTGRAVIGSG------TWDAVQARLERVAPMQAPPEPS 319
           +++ F   Q+  SR + ++ SGGTGRA +G G         A  A  E VAP   PP   
Sbjct: 178 DANVFYWFQNRKSRSKNKLRSGGTGRAGLGLGGNRASEPPAAATAHREAVAPSFTPPPIL 237

Query: 320 P 322
           P
Sbjct: 238 P 238


>11_06_0563 - 25018219-25018658,25020381-25020459
          Length = 172

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 18/45 (40%), Positives = 21/45 (46%)
 Frame = -3

Query: 336 GAMIEGLGSGGACIGATRSRRACTASHVPDPITARPVPPDISASN 202
           G ++ G GS G      R RRA   S  PDP  A  VPP   A +
Sbjct: 105 GLVLPGSGSNGPRPTRIRQRRA---SSRPDPAAAGLVPPGYGAKS 146


>08_01_0514 +
           4481383-4481903,4482532-4484590,4485038-4485107,
           4485434-4485660,4486238-4486324,4486408-4487114,
           4487206-4487270,4487323-4487837,4487898-4487991,
           4488116-4488398,4488494-4488689,4488913-4489254
          Length = 1721

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 12/53 (22%), Positives = 25/53 (47%)
 Frame = -1

Query: 320 GWVLVGPALEPPVLDGLARHPMCQIRSLHVQCLLIFQLQTWTSHLASVETLRI 162
           G + + P   P  L+       C ++ LH+    I ++  W S L +++ L++
Sbjct: 642 GNIHIWPGPYPLSLESCCPTTTCSLQKLHITYCFICKVPNWMSSLGNLKELKL 694


>10_08_0614 -
           19238064-19238132,19238381-19238407,19238436-19238510,
           19238637-19239317,19239423-19239554,19239676-19239723,
           19239828-19239878,19240015-19240134,19241121-19241261,
           19241701-19241865,19241981-19242160,19242314-19242445,
           19242536-19242643,19242779-19242883,19243217-19243321,
           19243407-19243463,19243991-19244010,19244299-19244377,
           19245021-19245080,19245562-19245615,19246535-19246600,
           19246938-19246990,19247361-19247450,19248152-19248249,
           19248348-19248721
          Length = 1029

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = -3

Query: 321 GLGSGGACIGATRSRRACTASHVPDPITARPVP-PDISASNLDI 193
           G GSGG     T  RR  ++S +  P+ + P P P  SA  L I
Sbjct: 62  GGGSGGGSRSTTPGRRGSSSSSLVGPVPSPPSPVPFPSAEELVI 105


>10_01_0079 - 1027655-1027863,1028416-1028619,1028858-1029485
          Length = 346

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = -1

Query: 299 ALEPPVLDGLARHPMCQIRSLHVQCLLIFQLQTWTSHLASVETLRIL 159
           A  PPVLD +  H + +I S  +  L+ F LQ+   HL+  E ++ L
Sbjct: 62  AAPPPVLDMIGPHILTRIESRSMYGLISF-LQSRYHHLSEHEIVQCL 107


>10_01_0074 + 977173-977309,978271-978351,978444-978459
          Length = 77

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = -3

Query: 333 AMIEGLGSGGACIGATRSRR 274
           A+ +G GSGG C G+ R RR
Sbjct: 9   ALGDGSGSGGRCCGSARRRR 28


>05_05_0044 - 21819193-21819418,21819531-21820759
          Length = 484

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 19/45 (42%), Positives = 22/45 (48%), Gaps = 6/45 (13%)
 Frame = +2

Query: 218 SGGTGRA-----VIGSGTWDAVQARLERVAPMQ-APPEPSPSIMA 334
           SGG G+        G   WD   ARL  VAP Q APP  + + MA
Sbjct: 278 SGGGGKVRPVAGATGDDRWDESLARLSGVAPQQPAPPAGTGAGMA 322


>01_06_1368 - 36715630-36715698,36715835-36716284
          Length = 172

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 14/43 (32%), Positives = 20/43 (46%)
 Frame = -3

Query: 336 GAMIEGLGSGGACIGATRSRRACTASHVPDPITARPVPPDISA 208
           GA   G+G G   +G        T     +P+ ARPVP ++ A
Sbjct: 78  GANGGGVGRGPGGVGDLGELLRWTREVAANPVAARPVPAEVKA 120


>01_01_1013 - 8015552-8015613,8016898-8018035
          Length = 399

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 11/17 (64%), Positives = 12/17 (70%)
 Frame = -1

Query: 305 GPALEPPVLDGLARHPM 255
           GP  EPPVLDG  R P+
Sbjct: 96  GPEPEPPVLDGFYRGPL 112


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,272,594
Number of Sequences: 37544
Number of extensions: 319374
Number of successful extensions: 1312
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 1226
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1308
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1431112012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).