SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0020
         (788 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_1282 + 27528159-27529148,27529549-27529614                      460   e-130
03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731...   459   e-129
11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306...   454   e-128
01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782...   454   e-128
05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32...   454   e-128
01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054...   454   e-128
10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910...   452   e-127
05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585...   452   e-127
12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323...   447   e-126
03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137...   442   e-124
08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981...   233   1e-61
08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160...   156   2e-38
02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980...   148   6e-36
08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207...   128   4e-30
01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931...   122   3e-28
01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238...    93   3e-19
04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182...    77   2e-14
04_03_0738 + 19169764-19169897,19169987-19170116,19170614-191706...    52   7e-07
03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324...    51   1e-06
07_03_0401 + 17724103-17724463,17724554-17724683,17725068-177250...    43   2e-04
07_03_0143 - 14315097-14315130,14315594-14315662,14316152-143162...    40   0.002
04_03_0904 + 20717005-20718087                                         36   0.049
07_03_1107 - 24024387-24024497,24025799-24026410                       35   0.064
01_03_0117 + 12684729-12685886,12685978-12686145,12686292-126863...    35   0.064
04_04_1125 + 31085106-31085714                                         34   0.15 
05_03_0458 + 14280953-14281866,14281964-14282912                       33   0.20 
07_03_1432 - 26508135-26508881,26509301-26509708                       33   0.26 
06_03_0905 + 25843547-25844314                                         33   0.26 
07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056...    33   0.34 
05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-28...    33   0.34 
11_06_0610 - 25449085-25453284                                         32   0.45 
10_08_1037 - 22477358-22478752                                         32   0.45 
01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983     32   0.45 
11_01_0551 + 4361640-4363386,4363443-4363687                           32   0.60 
07_03_1556 + 27692770-27694119                                         31   0.79 
06_03_1310 + 29238644-29240260                                         31   0.79 
05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365...    31   0.79 
09_02_0557 + 10639845-10639900,10640372-10640647,10640998-10641283     31   1.0  
11_01_0066 - 536281-537196,537397-537452                               31   1.4  
07_01_0538 + 3982952-3983297,3983397-3983489,3983627-3983733           31   1.4  
04_04_1126 + 31095651-31096115                                         31   1.4  
07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428...    30   1.8  
03_01_0024 - 214141-215097                                             30   1.8  
07_03_0077 - 13128304-13128943,13129269-13129300                       30   2.4  
05_01_0201 - 1441063-1443836,1444658-1445758,1446367-1447179,144...    30   2.4  
03_06_0129 - 31883732-31883854,31883989-31884051,31884213-318842...    30   2.4  
03_04_0044 + 16754638-16754676,16755472-16755598,16756325-167564...    30   2.4  
02_02_0140 + 7125914-7126264,7126426-7126677,7126766-7126861,712...    30   2.4  
12_02_1151 + 26488686-26488792,26488897-26489142,26490246-264903...    29   3.2  
11_01_0183 - 1440460-1440467,1440832-1440957,1440965-1442858           29   3.2  
10_07_0104 - 12907816-12908301                                         29   3.2  
06_03_0178 + 17594062-17595576                                         29   3.2  
05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18...    29   3.2  
02_05_0814 - 31970558-31971126,31971242-31971413                       29   3.2  
11_01_0485 + 3728686-3728863,3729933-3730095,3730508-3730549,373...    29   4.2  
08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336...    29   4.2  
03_05_0957 + 29195549-29196706,29198590-29198868                       29   4.2  
03_05_0214 + 22040356-22040886                                         29   4.2  
02_03_0132 - 15584673-15584789,15584957-15585054,15585151-15585550     29   4.2  
02_02_0328 - 9004670-9004753,9004873-9004947,9005031-9005132,900...    29   4.2  
10_06_0117 - 10948723-10948774,10949169-10949286,10949350-109494...    29   5.6  
06_03_1205 - 28406183-28406218,28406462-28406548,28406769-284068...    29   5.6  
05_07_0014 - 27046329-27046371,27059170-27060017,27060739-27061563     29   5.6  
04_04_0633 - 26771487-26771591,26771708-26771782,26771906-267719...    29   5.6  
03_01_0470 + 3619417-3619572,3619681-3619759,3620017-3620258,362...    29   5.6  
02_02_0572 + 11667455-11670783,11672026-11672419                       29   5.6  
01_01_1044 + 8231933-8231941,8232091-8232166,8232423-8232871           29   5.6  
12_02_0305 - 17235832-17236379,17237345-17237444                       28   7.4  
10_08_0029 + 14270945-14271364,14271449-14272486                       28   7.4  
07_03_0934 + 22735352-22735405,22736512-22736566,22737054-22737607     28   7.4  
06_01_0486 - 3455030-3455770                                           28   7.4  
04_04_0040 + 22322839-22324173                                         28   7.4  
03_06_0331 - 33181757-33181795,33182325-33182453,33182941-331829...    28   7.4  
03_01_0182 - 1466097-1466147,1466197-1466331,1466659-1466777,146...    28   7.4  
02_04_0179 + 20682852-20684510,20684593-20684661,20684741-206848...    28   7.4  
01_06_0365 + 28767538-28767696,28768299-28768520,28768630-287688...    28   7.4  
10_07_0154 + 13487971-13488168,13488259-13488483,13488592-134904...    28   9.7  
09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817           28   9.7  
08_02_1615 + 28257275-28258428,28258523-28259144                       28   9.7  
08_01_1006 - 10191817-10191822,10192449-10192745,10192826-101929...    28   9.7  
07_01_0766 - 5885207-5885791,5885874-5886224,5886252-5886269,588...    28   9.7  
06_03_1155 - 28065126-28065139,28065268-28065324,28065571-28066312     28   9.7  
06_01_0672 - 4903126-4903219,4903322-4903430,4903620-4905096,490...    28   9.7  
06_01_0121 - 932334-933074,933189-933272,934602-935006                 28   9.7  
03_06_0030 + 31161821-31161927,31163700-31163934,31164064-311648...    28   9.7  
03_05_0780 + 27646936-27647084,27647168-27647289,27649380-276494...    28   9.7  
03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093     28   9.7  
03_05_0267 - 22538631-22539452                                         28   9.7  
03_02_0811 + 11437654-11438958                                         28   9.7  
03_02_0809 + 11419318-11420493                                         28   9.7  
03_02_0308 - 7297228-7298008,7298495-7298576,7298612-7298669,729...    28   9.7  
03_01_0515 - 3864796-3865425                                           28   9.7  
02_01_0302 - 2021221-2023305                                           28   9.7  
01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350...    28   9.7  

>12_02_1282 + 27528159-27529148,27529549-27529614
          Length = 351

 Score =  460 bits (1133), Expect = e-130
 Identities = 215/234 (91%), Positives = 225/234 (96%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   DDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTDYLMKILTERGYSFTTTAEREIVRD+KEKL Y+ALDF+QEMATAA+ SS+
Sbjct: 185 RDLTDYLMKILTERGYSFTTTAEREIVRDVKEKLSYIALDFDQEMATAATGSSV 238


>03_05_0926 +
           28871800-28871859,28871943-28872336,28872586-28873199,
           28873281-28873346
          Length = 377

 Score =  459 bits (1131), Expect = e-129
 Identities = 215/234 (91%), Positives = 226/234 (96%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTDYLMKILTERGYSFTTTAEREIVRD+KEKL Y+ALD++QEM TA +SSS+
Sbjct: 185 RDLTDYLMKILTERGYSFTTTAEREIVRDMKEKLSYIALDYDQEMETAKTSSSV 238


>11_01_0403 +
           3059650-3059709,3059807-3060200,3060275-3060930,
           3060979-3061044
          Length = 391

 Score =  454 bits (1120), Expect = e-128
 Identities = 215/234 (91%), Positives = 223/234 (95%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTD LMKILTERGYSFTTTAEREIVRDIKEKL YVALD+EQE+  A SSSS+
Sbjct: 185 RDLTDSLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDYEQELEAAKSSSSV 238


>01_07_0285 -
           42476767-42476832,42476990-42477603,42477821-42478214,
           42478301-42478360
          Length = 377

 Score =  454 bits (1119), Expect = e-128
 Identities = 214/234 (91%), Positives = 224/234 (95%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTD LMKILTERGYSFTT+AEREIVRDIKEKL YVALD+EQE+ TA +SSS+
Sbjct: 185 RDLTDSLMKILTERGYSFTTSAEREIVRDIKEKLAYVALDYEQELETAKNSSSI 238


>05_01_0047 -
           323097-323162,323287-323900,324233-324626,324718-324777
          Length = 377

 Score =  454 bits (1118), Expect = e-128
 Identities = 214/234 (91%), Positives = 224/234 (95%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTD LMKILTERGYSFTT+AEREIVRDIKEKL YVALD+EQE+ TA +SSS+
Sbjct: 185 RDLTDSLMKILTERGYSFTTSAEREIVRDIKEKLAYVALDYEQELETAKNSSSV 238


>01_06_1455 +
           37504175-37504231,37504357-37504750,37504865-37505478,
           37506021-37506086
          Length = 376

 Score =  454 bits (1118), Expect = e-128
 Identities = 213/237 (89%), Positives = 224/237 (94%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           M +E++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQ
Sbjct: 1   MAEEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP+NPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG+ LPHAILRLD
Sbjct: 121 TQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFTLPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTD LMKILTERGYSFTTTAEREIVRDIKEKL YVALD+EQE+ TA SSSS+
Sbjct: 181 LAGRDLTDNLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDYEQELDTARSSSSI 237


>10_08_0597 +
           19089616-19089675,19089789-19090182,19090451-19091064,
           19091160-19091225
          Length = 377

 Score =  452 bits (1115), Expect = e-127
 Identities = 213/234 (91%), Positives = 224/234 (95%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETF+ PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFSVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTD LMKILTERGYSFTT+AEREIVRDIKEKL YVALD+EQE+ TA SSSS+
Sbjct: 185 RDLTDSLMKILTERGYSFTTSAEREIVRDIKEKLAYVALDYEQELETAKSSSSV 238


>05_04_0450 -
           21356877-21356942,21357482-21358095,21358173-21358566,
           21358648-21358704
          Length = 376

 Score =  452 bits (1113), Expect = e-127
 Identities = 211/237 (89%), Positives = 224/237 (94%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           M DE++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQ
Sbjct: 1   MADEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           +KRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPE+HPVLLTEAPLNPKANREKM
Sbjct: 61  AKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEDHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY LPHAILRLD
Sbjct: 121 TQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYTLPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTD+LMKILTERGYS TT+AEREIVRDIKEKL YVALD+EQE+ T+ SSSS+
Sbjct: 181 LAGRDLTDHLMKILTERGYSLTTSAEREIVRDIKEKLAYVALDYEQELETSRSSSSV 237


>12_01_0409 -
           3230853-3230918,3231372-3231994,3232454-3232847,
           3233000-3233059
          Length = 380

 Score =  447 bits (1102), Expect = e-126
 Identities = 210/233 (90%), Positives = 221/233 (94%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPALLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFE+FN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFESFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSS 783
           RDLTD LMKILTERGYSFTTTAEREIVRDIKEKL YVALD+EQE+  AA++ +
Sbjct: 185 RDLTDALMKILTERGYSFTTTAEREIVRDIKEKLAYVALDYEQELNAAAAAKN 237


>03_06_0585 -
           34912159-34912224,34912634-34913247,34913350-34913734,
           34913824-34913883
          Length = 374

 Score =  442 bits (1088), Expect = e-124
 Identities = 210/234 (89%), Positives = 220/234 (94%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQI
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFN PAMYVAIQAVLSLYASGR   IVLDSGDGV+HTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFNAPAMYVAIQAVLSLYASGR---IVLDSGDGVTHTVPIYEGYALPHAILRLDLAG 181

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTD LMKILTERGYSFTTTAEREIVRDIKEKL Y+ALD+EQE+ TA SSSS+
Sbjct: 182 RDLTDCLMKILTERGYSFTTTAEREIVRDIKEKLAYIALDYEQELETAKSSSSV 235


>08_02_0441 -
           17196352-17196536,17196780-17196906,17198018-17198101,
           17198282-17198348,17198575-17198633,17199211-17199336,
           17199406-17199474,17199545-17199653,17199692-17199760,
           17199876-17199979,17200518-17200567,17200696-17200774,
           17200867-17200938,17201083-17201217,17201311-17201421,
           17202088-17202129
          Length = 495

 Score =  233 bits (570), Expect = 1e-61
 Identities = 106/216 (49%), Positives = 149/216 (68%), Gaps = 2/216 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  +      D  VG      R  L
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLQEQELTDIVVGAACADLRHQL 66

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
            + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP  NREKM + MFE
Sbjct: 67  DVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKMIETMFE 126

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
            +N   +++ +QAVLSLYA G  TG+V+DSGDGV+H VP+ +G++ PH   R+++AGR +
Sbjct: 127 KYNFAGVFIQVQAVLSLYAQGLLTGLVIDSGDGVTHVVPVVDGFSYPHITKRMNVAGRHI 186

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVAL 741
           T YL+ +L+ RGY+   +A+ E VR+IKEKLCY++L
Sbjct: 187 TSYLVDLLSRRGYAMNKSADFETVREIKEKLCYLSL 222


>08_01_0194 -
           1603702-1603782,1603970-1604062,1604203-1604328,
           1604403-1604513,1604989-1605108,1605665-1605757,
           1606024-1606157,1606503-1606530,1606821-1607075,
           1607167-1607401,1608147-1608193
          Length = 440

 Score =  156 bits (379), Expect = 2e-38
 Identities = 91/258 (35%), Positives = 133/258 (51%), Gaps = 38/258 (14%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH---QGVMVG------------MGQKD 231
           A+V+DNG+G  K GF+G+  P    P++V        Q  M              M   D
Sbjct: 8   AVVIDNGTGYSKLGFSGNSEPCFTIPTVVAVNESFLDQSEMCSSANWIAQYNAGVMADLD 67

Query: 232 SYVGDEAQS---KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 402
            ++GDEA S     G+ T K+PI HG V +WD ME+ W    +N LR  PEEH  LLT++
Sbjct: 68  FFIGDEALSLFKSSGLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYFLLTDS 127

Query: 403 PLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL--------------------YASGRT 522
           P++   +RE   +IMFETFN P +Y+++Q+VLSL                    +A    
Sbjct: 128 PVSTPESRECAGEIMFETFNVPGLYISVQSVLSLSAGYAFLKSISDEDSVSVFCFAIPLY 187

Query: 523 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREI 702
           TG+V+D GDG  H VP+  GY +  +I     +G D+T +++++L ERG         +I
Sbjct: 188 TGVVVDIGDGAPHVVPVVNGYVIGSSIKSFPFSGSDVTQFVLQLLQERGELIAPEDSLDI 247

Query: 703 VRDIKEKLCYVALDFEQE 756
            R +KE  CY + D  +E
Sbjct: 248 ARRVKEMYCYTSSDIVKE 265


>02_04_0473 +
           23197294-23197340,23197443-23197680,23197792-23198016,
           23198616-23198762,23198827-23198961,23199415-23199507,
           23199925-23200044,23200303-23200413,23200486-23200611,
           23200731-23200829,23201024-23201104
          Length = 473

 Score =  148 bits (358), Expect = 6e-36
 Identities = 81/211 (38%), Positives = 121/211 (57%), Gaps = 24/211 (11%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRH---QGVMVG------MGQK 228
           A+V+DNG+G  K GFAG+  P  + P++V       G+ R    +G  +       M   
Sbjct: 8   AVVIDNGTGYTKMGFAGNVEPCFITPTVVAVNDTFAGQTRANTTKGNWMAQHSAGVMADL 67

Query: 229 DSYVGDEAQSKR---GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 399
           D ++G++A ++        L YPI +G V NWD ME+ W    +N LR  PE+H  LLTE
Sbjct: 68  DFFIGEDALARSRSSNTYNLSYPIHNGQVENWDTMERFWQQCIFNYLRCDPEDHYFLLTE 127

Query: 400 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT-----TGIVLDSGDGVSHT 564
           +PL P   RE   +IMFETFN P +Y+A Q VL+L A   T     TG+V+D GDG +H 
Sbjct: 128 SPLTPPETREYTGEIMFETFNVPGLYIACQPVLALAAGYTTTKCEMTGVVVDVGDGATHI 187

Query: 565 VPIYEGYALPHAILRLDLAGRDLTDYLMKIL 657
           VP+ +GY +  +I  + + G+D+T ++ ++L
Sbjct: 188 VPVADGYVIGSSIRSIPITGKDVTQFIQQLL 218


>08_01_0254 +
           2078380-2078392,2078487-2078578,2079579-2079698,
           2079924-2080097,2080184-2080257,2080847-2080927,
           2081306-2081366,2081437-2081486,2082278-2082332,
           2082599-2082676,2082757-2082810,2083703-2083756,
           2083846-2083906,2084229-2084280,2085118-2085184,
           2085393-2085452,2085546-2085608,2085752-2085814,
           2086337-2086401,2086620-2086688,2086742-2086847
          Length = 503

 Score =  128 bits (310), Expect = 4e-30
 Identities = 57/145 (39%), Positives = 89/145 (61%)
 Frame = +1

Query: 235 YVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 414
           YVG E + +R  + +  P++ G VT+WD ++ IW+H F   L + PEEHP+L+ E   N 
Sbjct: 120 YVGQELEFRRDHMEVISPMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTNT 179

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 594
              REK  ++MFE +  PA+++A  AVL+ +ASGR T +V+DSG G +    +++GY L 
Sbjct: 180 GQQREKAAELMFEKYKVPALFLAKNAVLTSFASGRATSLVVDSGGGSTVVAAVHDGYVLQ 239

Query: 595 HAILRLDLAGRDLTDYLMKILTERG 669
            ++    + G  LTD +MK L  +G
Sbjct: 240 KSVATSPIGGEFLTDCMMKSLESKG 264



 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 180
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36


>01_01_1170 -
           9318332-9318461,9318551-9318613,9318694-9318744,
           9318837-9318921,9319005-9319068,9319139-9319340,
           9319808-9320502
          Length = 429

 Score =  122 bits (294), Expect = 3e-28
 Identities = 75/239 (31%), Positives = 125/239 (52%), Gaps = 11/239 (4%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI--- 270
           +V+DNG G+ KAGF GD  P AV P+ + +P         G K   V D+ Q++      
Sbjct: 8   VVLDNGGGLLKAGFGGDMNPTAVVPNCMAKPP--------GSKKWLVADQLQAQDVDVTG 59

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
           +TL+ PI+ G + N +   ++W     N L+V P    +LL E   NP A +    +++F
Sbjct: 60  MTLRRPIDRGYLINQEVQREVWERVIRNLLQVDPNNSSLLLVEPQFNPPALQHATDELVF 119

Query: 451 ETFNTPAMYVA-IQAVLSLYASGR-------TTGIVLDSGDGVSHTVPIYEGYALPHAIL 606
           E     ++ VA   +++ LY + R          +V+D G   +H  P+ + + L +A+ 
Sbjct: 120 EELGFKSLCVADAPSLVHLYEASRQPSLFRAQCSLVVDCGFSFTHASPVLQNFTLNYAVR 179

Query: 607 RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSS 783
           R+DL G+ LT+YL ++++ R  S     E  ++ D KEKLC+V+LD   ++  A  SS+
Sbjct: 180 RMDLGGKALTNYLKELISYR--SLNVMDETLLIDDAKEKLCFVSLDVPGDLRLARLSSN 236


>01_01_0292 -
           2387653-2387711,2388061-2388684,2388814-2389104,
           2389338-2389390,2390496-2390968,2391090-2391432,
           2391793-2391911,2392081-2392512,2392657-2392747,
           2392833-2392942,2393681-2393875,2394581-2394622,
           2395144-2395268,2395856-2395926,2396047-2396147
          Length = 1042

 Score = 92.7 bits (220), Expect = 3e-19
 Identities = 64/229 (27%), Positives = 119/229 (51%), Gaps = 9/229 (3%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE--AQSKRGIL 273
           +V+DNG+   + G+AG+  PR  F +IV RPRH+      G+  + VGD   A  K    
Sbjct: 22  IVIDNGASTFRIGWAGEAEPRVAFRNIVQRPRHRS----SGETVTVVGDTDPALMKYFDC 77

Query: 274 T---LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           T   ++ P +  +V  ++ ME I    F      +   HP+L+TE   NP  +R +M+++
Sbjct: 78  TRSAIRSPFDDDVVYQFEYMEYILDFGFDRLGATSEVGHPILMTECECNPSFSRARMSEL 137

Query: 445 MFETFNTPAM----YVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           +FET+  P++    Y+ +  +  ++ S      ++D+ D  S+     +G  +  A  R 
Sbjct: 138 LFETYGVPSIGNDTYLFVPLLSIVHGSFEVR--IVDAKDVSSY---FLKGEPVLGACCRT 192

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           ++ G  +TD+L ++L+ +    + +   E   ++K++ CYVALD+  E+
Sbjct: 193 NVGGFHITDFLRQLLSLKYPYHSASITWEKAEELKKEHCYVALDYMSEL 241


>04_04_1515 +
           34117383-34117732,34117833-34117918,34118227-34118297,
           34118457-34118524,34118692-34118753,34119010-34119107,
           34119545-34119626,34119935-34120077,34120233-34120381,
           34120461-34120594,34120714-34120832,34120926-34121014,
           34121398-34121515
          Length = 522

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 50/149 (33%), Positives = 81/149 (54%), Gaps = 11/149 (7%)
 Frame = +1

Query: 343 TFYNELRVAPEEHPVLL---------TE-APLNPKANREKMTQIMFETFNTPAMYVAIQA 492
           T Y  ++V P   P+++         TE A  + K  R+ +  ++F+  N PA+    QA
Sbjct: 188 TIYTRMQVKPSTQPIIVVLPLCHSDDTESARASRKQYRDTLYSVLFD-MNVPAVCSVDQA 246

Query: 493 VLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPH-AILRLDLAGRDLTDYLMKILTERG 669
           VL+LYA+ RT+GIV++ G   +  VPI++G  +    +  +      LT +L +++ +R 
Sbjct: 247 VLALYAAKRTSGIVVNIGFNATSIVPIFQGRVMHEIGVETVGQGALKLTGFLKELMQQRN 306

Query: 670 YSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            +F +      VR IKEKLCYVA D+E E
Sbjct: 307 ITFESL---YTVRTIKEKLCYVAADYEAE 332


>04_03_0738 +
           19169764-19169897,19169987-19170116,19170614-19170687,
           19171208-19171288,19172054-19172087
          Length = 150

 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = +1

Query: 286 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           P++ G   +WD ++ IW+H F   L + PEEHP+L+ E   N    REK
Sbjct: 92  PMKDGTFIDWDIVDNIWNHAFRQRLLINPEEHPMLIVEPSTNTGQQREK 140


>03_06_0192 +
           32230953-32231030,32231130-32231485,32232250-32232425,
           32233857-32234038,32234260-32234443,32235192-32235259,
           32235343-32235495
          Length = 398

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 24/46 (52%), Positives = 31/46 (67%)
 Frame = +1

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDG 552
           +A RE++ Q+MFE FN    Y + QAVLSLYA GR +G  +D G G
Sbjct: 156 QALREQLAQLMFEKFNVSGFYDSEQAVLSLYAVGRISGCTVDIGHG 201



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 33/109 (30%), Positives = 51/109 (46%), Gaps = 2/109 (1%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           A+VVD GS + KAG A  D +P  V PS           + +  +D  +GD A  +  + 
Sbjct: 3   AVVVDAGSKLLKAGIALPDQSPSLVMPS----------KMKLEVEDGQMGDGAVVEEVV- 51

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELR-VAPEEHPVLLTEAPLNPK 417
               P+  G V +WD ME + ++  Y+ +     +E  +L TE    PK
Sbjct: 52  ---QPVVRGFVKDWDAMEDLLNYVLYSNIGWEIGDEGQILFTEPLFTPK 97


>07_03_0401 +
           17724103-17724463,17724554-17724683,17725068-17725083,
           17725130-17725203,17725693-17725761,17726224-17726257
          Length = 227

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +1

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           ++R  + +  P++ G   +WD ++ IW+H F       PEEHP+L+ E   N    REK
Sbjct: 163 NRRDHMEVISPMKDGTFIDWDIVDNIWNHAF----SFYPEEHPMLIVEPSTNTGQQREK 217


>07_03_0143 -
           14315097-14315130,14315594-14315662,14316152-14316225,
           14316316-14316331,14316716-14316845,14316936-14316999
          Length = 128

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = +1

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           ++R  + +  P++ G   +WD ++ IW+H F        EEHP+L+ E   N    REK
Sbjct: 64  NRRDHMEVISPMKDGTFIDWDIVDNIWNHAF----SFYAEEHPMLIVEPSTNTGQQREK 118


>04_03_0904 + 20717005-20718087
          Length = 360

 Score = 35.5 bits (78), Expect = 0.049
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPST-KDTHSPTP 601
           H+  PP  +P+    + T P   P    TPA  +PTP P T K    PTP
Sbjct: 105 HTPTPPTYTPTPTPPKPTPPTYKPQPKPTPAPYTPTPTPPTYKPQPKPTP 154



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 4/54 (7%)
 Frame = +2

Query: 452 KHSTRPPCTSPS-KPCSRCTRPV-VPPVSCWTPATVSPTPCP--STKDTHSPTP 601
           K +  PP  +P+ KP      P   PP    TP T +PTP P   T  T+ P P
Sbjct: 77  KPTPTPPTYTPTPKPTPPPYTPKPTPPAHTPTPPTYTPTPTPPKPTPPTYKPQP 130



 Score = 29.5 bits (63), Expect = 3.2
 Identities = 17/45 (37%), Positives = 20/45 (44%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           P  +P KP  + T     P    TP T +PTP P     H P PS
Sbjct: 310 PTPTPYKPQPKPTPSPYTPKPTPTPPTYTPTPTP---PYHKPPPS 351



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCT-RPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP  +P+ P    T +P  PP   +TP    P   P T  T++PTP+
Sbjct: 75  PPKPTPTPPTYTPTPKPTPPP---YTPKPTPPAHTP-TPPTYTPTPT 117


>07_03_1107 - 24024387-24024497,24025799-24026410
          Length = 240

 Score = 35.1 bits (77), Expect = 0.064
 Identities = 18/49 (36%), Positives = 24/49 (48%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           +T PP  S + P +  T P  P      P T +PT  P TK T +P P+
Sbjct: 52  TTTPPAAS-TPPAAAPTTPATP-APAEAPTTPAPTKAPPTKSTKAPAPA 98


>01_03_0117 +
           12684729-12685886,12685978-12686145,12686292-12686336,
           12686438-12687280
          Length = 737

 Score = 35.1 bits (77), Expect = 0.064
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 7/64 (10%)
 Frame = +2

Query: 452 KHS-TRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPT------PCPSTKDTHSPTPSCV 610
           +HS ++PP  +P+KP +   RP +PP +   P +V+P       P P+TK   S  P   
Sbjct: 212 RHSPSKPPAYAPAKPPT-ALRPAIPPAAMPKPPSVAPVQPPQRPPAPATKPPPSFPPQLA 270

Query: 611 WT*P 622
            T P
Sbjct: 271 PTMP 274


>04_04_1125 + 31085106-31085714
          Length = 202

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 1/46 (2%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSP-TP 601
           PPC  P  P      P  PP   WTP   +PTP   T  T +P TP
Sbjct: 42  PPC-QPPPPTPTPATPTTPPTP-WTPPPATPTPPTPTPWTPTPATP 85



 Score = 33.1 bits (72), Expect = 0.26
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSP-TPCPSTKDTHSPTPSCVWT*P 622
           PP  +P+ P +  T P  PP +  TP T +P TP P+T      TP+   T P
Sbjct: 48  PPTPTPATPTTPPT-PWTPPPATPTPPTPTPWTPTPATPPPTPATPATPTTPP 99



 Score = 31.9 bits (69), Expect = 0.60
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = +2

Query: 461 TRPPCT-SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           T PP T +P  P      P  PP +  TPAT +  P P+   + +PT  C
Sbjct: 64  TPPPATPTPPTPTPWTPTPATPPPTPATPATPTTPPTPAPAPS-TPTGKC 112



 Score = 31.5 bits (68), Expect = 0.79
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHS--PTPS 604
           P T P+        P  P  + WTP   +P P P+T  T +  PTP+
Sbjct: 56  PTTPPTPWTPPPATPTPPTPTPWTPTPATPPPTPATPATPTTPPTPA 102



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 17/44 (38%), Positives = 19/44 (43%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           P T P  P      P  PP    TPAT +  P P T    +PTP
Sbjct: 35  PTTKPPPP------PCQPPPPTPTPATPTTPPTPWTPPPATPTP 72



 Score = 27.9 bits (59), Expect = 9.7
 Identities = 18/42 (42%), Positives = 19/42 (45%)
 Frame = +2

Query: 497 SRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           S C     PP  C  P    PTP P+T  T  PTP   WT P
Sbjct: 32  SNCPTTKPPPPPCQPP---PPTPTPATPTT-PPTP---WTPP 66


>05_03_0458 + 14280953-14281866,14281964-14282912
          Length = 620

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
           CS H T PP  SP+   S  + P VP     TP + S + C +     +PT
Sbjct: 85  CSSHPTPPPPPSPTTSPSASSLPPVP-----TPRSASSSKCSAPTSAQTPT 130



 Score = 29.5 bits (63), Expect = 3.2
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 6/54 (11%)
 Frame = +2

Query: 458 STRPPCTSPSKPCS----RCTRPVVPP--VSCWTPATVSPTPCPSTKDTHSPTP 601
           +T  P +SPS P      + T P +PP  +SC +  T  P P P+T  + S  P
Sbjct: 54  TTSSPSSSPSSPPPLPPLQPTPPPLPPTTLSCSSHPTPPPPPSPTTSPSASSLP 107


>07_03_1432 - 26508135-26508881,26509301-26509708
          Length = 384

 Score = 33.1 bits (72), Expect = 0.26
 Identities = 23/47 (48%), Positives = 25/47 (53%), Gaps = 3/47 (6%)
 Frame = +2

Query: 470 PCTSPSKPC-SRCTRPVVPPVSCWTP--ATVSPTPCPSTKDTHSPTP 601
           P T PS P  S  T P  PP S   P  A VSP+P P+T    SPTP
Sbjct: 31  PITYPSPPSLSPSTPPTYPPPSSTPPSLAPVSPSP-PTTYLPPSPTP 76



 Score = 31.5 bits (68), Expect = 0.79
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPAT-VSPTPCPSTKDTHSPTP 601
           P T P+ P    T P + PVS   P T + P+P P +    SP+P
Sbjct: 42  PSTPPTYPPPSSTPPSLAPVSPSPPTTYLPPSPTPPSPAPASPSP 86


>06_03_0905 + 25843547-25844314
          Length = 255

 Score = 33.1 bits (72), Expect = 0.26
 Identities = 22/49 (44%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVV--PPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           PP T P+ P +  T PVV  PPV+  TP    PTP P T  T   T  C
Sbjct: 117 PPVTYPTPPVT--TPPVVVGPPVTYPTPPVTYPTP-PVTYPTPPTTTPC 162



 Score = 29.9 bits (64), Expect = 2.4
 Identities = 17/46 (36%), Positives = 20/46 (43%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP T P+ P +  T PV  P    TP T +P P P       P  S
Sbjct: 135 PPVTYPTPPVTYPTPPVTYP----TPPTTTPCPPPPPATQRCPVDS 176



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVV--PPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           PP T P+ P +  T PVV  PPV+  TP   +P        T+ PTP   +  P
Sbjct: 99  PPVTYPTPPVT--TPPVVVGPPVTYPTPPVTTPPVVVGPPVTY-PTPPVTYPTP 149


>07_03_1710 -
           28903614-28903673,28904982-28905146,28905453-28905638,
           28905784-28905927,28906281-28906460,28906559-28907215
          Length = 463

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 15/45 (33%), Positives = 18/45 (40%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           PP  +   P S       PP    TP   SP P P+   T  P+P
Sbjct: 39  PPSPTTCYPVSSAAPTAPPPKPSPTPPPASPPPAPTPPQTRPPSP 83



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 15/35 (42%), Positives = 16/35 (45%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTP 565
           T PP + P  P    TRP  PP     P  VSP P
Sbjct: 63  TPPPASPPPAPTPPQTRPPSPPPQQQQPRPVSPPP 97


>05_01_0041 +
           281427-281549,281671-281730,281822-281868,282013-282089,
           285368-285440,286193-286281,286665-286711,286805-286885,
           287011-287179,287381-287600,287679-287744,288194-288310,
           288591-288628,288935-289032
          Length = 434

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 36/105 (34%), Positives = 45/105 (42%), Gaps = 5/105 (4%)
 Frame = +3

Query: 366 RPRGTPSPA-H*GSP--QPQGQQREDDPDHV-RNIQHARHVRRHPSRALAVRVRSYHRYR 533
           R R  PSP  H G+P  +P    R   P    R ++  RH+     R   +R RS     
Sbjct: 290 RRRTAPSPIRHGGTPSRRPGSPIRRRSPSPPPRRLRSPRHLSPRRDRGSPIRRRSPLP-- 347

Query: 534 AGLRRRCLPHRAHLRRIRTPPRHPASGLSRSR-PHRLPHEDPHRA 665
              RRR  P R    R+ +PPR P S   RSR P   P   P R+
Sbjct: 348 ---RRRLTPPR----RMWSPPRRPQSLRHRSRSPIHRPIRSPSRS 385


>11_06_0610 - 25449085-25453284
          Length = 1399

 Score = 32.3 bits (70), Expect = 0.45
 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 4/56 (7%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCW----TPATVSPTPCPSTKDTHSPTP 601
           CSKH   P   +P KP     +P + PV       +PA   P   PST  +H P P
Sbjct: 408 CSKHVC-PGHPTPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHGPPP 462



 Score = 29.1 bits (62), Expect = 4.2
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = +2

Query: 449 SKHSTRPPCT-SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSP 595
           + H   PP   SP +P    T P   P S  +PA ++P P P+ K   SP
Sbjct: 456 TSHGPPPPEEESPEEPPEEPT-PSPTPSSPESPAKMAPPPAPAIKGVTSP 504


>10_08_1037 - 22477358-22478752
          Length = 464

 Score = 32.3 bits (70), Expect = 0.45
 Identities = 29/101 (28%), Positives = 37/101 (36%), Gaps = 1/101 (0%)
 Frame = +3

Query: 363 CRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRH-PSRALAVRVRSYHRYRAG 539
           C P   PSP H    Q Q QQ++  P         +H + H  + A A  V       AG
Sbjct: 159 CSPPPIPSPVHRHGSQQQ-QQQQQQPASRGQQARPQHPQGHATAAAAAAAVTPAAAAAAG 217

Query: 540 LRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHR 662
           L+ +  P   H     +P  H    L  S P       PHR
Sbjct: 218 LQHQQEPVPRH-----SPAAHRGDPLPASPPQPQHQHHPHR 253


>01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983
          Length = 448

 Score = 32.3 bits (70), Expect = 0.45
 Identities = 30/79 (37%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = -3

Query: 693 LGGGSERVAALGEDLHEVVCEVATG*VQTQ-DGVGECVSFVDGHGVG--DTVAGVQHDTG 523
           LGGG E + A G        +  TG V     GVG  V F DG G G  +T  G    TG
Sbjct: 40  LGGGGEALGAGGLGTSGGGDDGTTGGVGVGVTGVGVGVGFGDGTGGGGGNTGGGGGEVTG 99

Query: 522 GTTGRVQREHGLDGDVHGG 466
           G  G V    G+ G   GG
Sbjct: 100 GGGGGVAEGTGIGGGGGGG 118


>11_01_0551 + 4361640-4363386,4363443-4363687
          Length = 663

 Score = 31.9 bits (69), Expect = 0.60
 Identities = 20/62 (32%), Positives = 31/62 (50%)
 Frame = +1

Query: 484 IQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 663
           IQ+     A GR + + LD G GV+     + GY   H +L + LA +D  +  ++   E
Sbjct: 453 IQSSFPEVAWGRRSRVALDVGCGVAS----FGGYLFDHDVLTMSLAPKDEHEAQVQFALE 508

Query: 664 RG 669
           RG
Sbjct: 509 RG 510


>07_03_1556 + 27692770-27694119
          Length = 449

 Score = 31.5 bits (68), Expect = 0.79
 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%)
 Frame = +2

Query: 491 PCSRCTR-PVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           PCS C   P   P +    A+  P PC S +   +P PSC
Sbjct: 134 PCSGCAGCPTSSPFNPAASASYRPVPCGSPQCVLAPNPSC 173


>06_03_1310 + 29238644-29240260
          Length = 538

 Score = 31.5 bits (68), Expect = 0.79
 Identities = 19/58 (32%), Positives = 24/58 (41%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           S H   PP +S S P       V+PP++   P T  P        T S  PS  W+ P
Sbjct: 432 SSHGASPPSSSSSPPTEH-PGYVLPPLTPPPPTTTPPGHHAPVPGTPSSPPSSSWSPP 488


>05_01_0004 -
           34967-35149,35340-35501,36078-36225,36309-36385,
           36507-36577,36850-37263,37518-38268
          Length = 601

 Score = 31.5 bits (68), Expect = 0.79
 Identities = 22/61 (36%), Positives = 27/61 (44%), Gaps = 9/61 (14%)
 Frame = +2

Query: 467 PPCTSPS--KPCSRCTRPVVPPVSCWT-------PATVSPTPCPSTKDTHSPTPSCVWT* 619
           PP  SPS  KP S+  +  +PP +  T       PA   P   PS     SPTP+   T 
Sbjct: 85  PPRNSPSPPKPPSQAAQSPLPPTTTTTTPPTAPVPAAAPPPTAPSPYSAPSPTPTPTHTQ 144

Query: 620 P 622
           P
Sbjct: 145 P 145


>09_02_0557 + 10639845-10639900,10640372-10640647,10640998-10641283
          Length = 205

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)
 Frame = +2

Query: 479 SPSKPCSRCTRPVVPPVSCWTPATVSPTP-CPST 577
           SP+  C R  RP  PP +C  P   +PTP  P+T
Sbjct: 53  SPADLCRRSARPSTPPAAC-QPEPPAPTPKAPNT 85


>11_01_0066 - 536281-537196,537397-537452
          Length = 323

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 9/58 (15%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWT--------PATVSPTP-CPSTKDTHSPTPSCVW 613
           PP  SP+   +R + P  PP+   T         ATV+PTP  P +  T +P P+ VW
Sbjct: 238 PPPPSPTPTTTRAS-PTPPPIPTATVRPPPPLPRATVTPTPTTPPSTATTTPIPTWVW 294



 Score = 29.1 bits (62), Expect = 4.2
 Identities = 18/48 (37%), Positives = 20/48 (41%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           +T PP  +   P S  T P  PP    T    SPTP P    T  P P
Sbjct: 221 ATPPPSPASPPPPSTATPP--PPSPTPTTTRASPTPPPIPTATVRPPP 266


>07_01_0538 + 3982952-3983297,3983397-3983489,3983627-3983733
          Length = 181

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 15/44 (34%), Positives = 23/44 (52%)
 Frame = +2

Query: 473 CTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           C   + P S+CT    PP +  TP T++  P  + +D  SP P+
Sbjct: 104 CKVQAPPISQCTAVPTPPPAPDTP-TLADEPAETNEDEPSPPPA 146


>04_04_1126 + 31095651-31096115
          Length = 154

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 15/43 (34%), Positives = 19/43 (44%)
 Frame = +2

Query: 479 SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           +P+  CS C  P  PP     P+ V   P P T    +PT  C
Sbjct: 28  APAAACSYCPTPKPPPPPPPAPSGVPCPPPPYTPTPATPTGKC 70


>07_01_0577 -
           4286048-4286186,4286600-4286660,4286957-4287089,
           4287286-4287350,4288346-4288451,4288529-4288750,
           4289619-4289852,4289948-4290037,4290605-4291507
          Length = 650

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 19/49 (38%), Positives = 25/49 (51%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           +T PP   P  P    T P +PP S  TP T  P P  ST+ + +P P+
Sbjct: 53  ATPPPPPPPPTPAVEPTLP-IPPAS--TPPT-PPQPSASTEPSTAPPPA 97


>03_01_0024 - 214141-215097
          Length = 318

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 20/48 (41%), Positives = 23/48 (47%), Gaps = 1/48 (2%)
 Frame = +3

Query: 558 PHRAHLR-RIRTPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRRAG 698
           PHR  L+ R+R   RH A+ L R  P R     P R R LV  H   G
Sbjct: 15  PHRQLLQERLRLRLRH-AAHLHRHEPRRRQRRPPRRRRRLVAPHPHGG 61


>07_03_0077 - 13128304-13128943,13129269-13129300
          Length = 223

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 1/29 (3%)
 Frame = +3

Query: 531 RAGLRR-RCLPHRAHLRRIRTPPRHPASG 614
           RAGL   R + HRA +R  R P RHP SG
Sbjct: 77  RAGLLPVRGVDHRARVRAPRAPRRHPRSG 105


>05_01_0201 -
           1441063-1443836,1444658-1445758,1446367-1447179,
           1447386-1447440
          Length = 1580

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%)
 Frame = +2

Query: 503 CTRPVVPP--VSCWTP-ATVSPTPCPSTKDTHSPTPSC 607
           C  PV  P    C +P A  SP PC S     SP P C
Sbjct: 249 CVSPVAAPSPTPCASPVAAPSPAPCVSPVAAPSPAPPC 286


>03_06_0129 -
           31883732-31883854,31883989-31884051,31884213-31884272,
           31884724-31884784,31884934-31885004,31885313-31885389,
           31885856-31885913,31885995-31886048,31886279-31886297,
           31886359-31886466,31886574-31886690,31886836-31886919,
           31887079-31887171,31887279-31887499,31888294-31888371,
           31889237-31889499,31890109-31890247
          Length = 562

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = -1

Query: 605 RMAWGSAYPS*MGTVWETPSPESSTIPV 522
           RM  G+  P+  G +W TPS E  TI V
Sbjct: 52  RMETGAVEPASTGAIWSTPSVEPRTISV 79


>03_04_0044 +
           16754638-16754676,16755472-16755598,16756325-16756451,
           16756866-16757431,16757896-16758211,16758373-16758613,
           16758734-16758823,16759343-16759780,16759877-16760185,
           16760392-16760406
          Length = 755

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = +2

Query: 458 STRPPCTSP--SKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKD-THSPTPSCV 610
           S+RP  +S   SKP +    P V P   W P +VSP+P     +  HS   S V
Sbjct: 265 SSRPSSSSQYHSKPNTPVGHPKVNPQLEWKPKSVSPSPANHADNVVHSSAASSV 318


>02_02_0140 +
           7125914-7126264,7126426-7126677,7126766-7126861,
           7127013-7127187,7127283-7127363,7127451-7127548,
           7127828-7127920,7128607-7128678,7128998-7129117,
           7129210-7129260,7130026-7130211,7130355-7130411
          Length = 543

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 17/45 (37%), Positives = 20/45 (44%)
 Frame = +3

Query: 486 PSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLS 620
           P  +LA   R Y     G RRR  P     RR R PPR   + L+
Sbjct: 57  PHSSLAAASRHYASSTPGRRRRAPPMLLRRRRARRPPREGPAELN 101


>12_02_1151 +
           26488686-26488792,26488897-26489142,26490246-26490381,
           26490502-26490561,26490648-26490740,26491421-26491663,
           26491828-26491968,26492312-26492482,26492813-26492899,
           26492954-26493211,26493300-26493445,26493535-26493922,
           26493935-26494092,26494267-26494540,26494721-26494894
          Length = 893

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 26/109 (23%), Positives = 42/109 (38%), Gaps = 3/109 (2%)
 Frame = +1

Query: 217 MGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 396
           + + DS + D  Q K  +  +K+P   G+V     +   W H  Y    V P+   V +T
Sbjct: 387 IARNDSIIVDICQRKGSVGQIKFPSLAGVVVALLFLLPKWTHGQYKSTLVCPDCRKVSVT 446

Query: 397 EAP---LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIV 534
             P   L+       M  +    FNT          +S+  SG T  ++
Sbjct: 447 FDPFMYLSLPLPSTTMRTMTITVFNTDGTTGPSPYTVSVPKSGDTKTLI 495


>11_01_0183 - 1440460-1440467,1440832-1440957,1440965-1442858
          Length = 675

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%)
 Frame = +2

Query: 479 SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHS-PTP 601
           +PS PCS   +P   P S   P   SP P  +T  + + PTP
Sbjct: 48  TPSIPCSSSEQPQEAPASFSLPLPKSPVPIKATPISAAFPTP 89


>10_07_0104 - 12907816-12908301
          Length = 161

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 13/25 (52%), Positives = 14/25 (56%)
 Frame = -2

Query: 538 PARYRWYDRTRTARARLGWRRTWRA 464
           PA  RW  R   ARAR GWR   R+
Sbjct: 134 PAARRWSGRWSAARARSGWREGTRS 158


>06_03_0178 + 17594062-17595576
          Length = 504

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 539 TPATVSPTPCPSTKDTHSPTPS 604
           +P  +SP+P PST    SPTPS
Sbjct: 8   SPRHLSPSPAPSTPRPSSPTPS 29


>05_01_0028 +
           182528-183852,183967-184127,184872-185116,185330-186073
          Length = 824

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 2/47 (4%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVP--PVSCWTPATVSPTPCPSTKDTHSPTP 601
           PP   P +   R   P  P  P     PA++SPTP P      +P P
Sbjct: 76  PPAPRPPRRHHRIPPPPPPLLPTPPPPPASISPTPAPPLPPPPAPAP 122


>02_05_0814 - 31970558-31971126,31971242-31971413
          Length = 246

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 19/50 (38%), Positives = 22/50 (44%), Gaps = 1/50 (2%)
 Frame = +2

Query: 476 TSPSKPCSRCTRPVVPPVSCWTPATVSP-TPCPSTKDTHSPTPSCVWT*P 622
           +SPS P      P  P  +   P+T  P TP PST  T   TP    T P
Sbjct: 145 SSPSSPTPTTPNPSTPTPTTPYPSTPMPTTPYPSTPMTTPTTPYTTPTSP 194


>11_01_0485 +
           3728686-3728863,3729933-3730095,3730508-3730549,
           3730833-3730927,3731273-3731334,3731416-3731507,
           3731587-3731722,3731818-3731904,3732430-3732519,
           3732969-3733071,3733616-3733716,3733837-3733971,
           3734006-3734093,3734484-3734544,3734626-3734689,
           3735219-3735347
          Length = 541

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 38/116 (32%), Positives = 47/116 (40%), Gaps = 7/116 (6%)
 Frame = -3

Query: 786 EGAAGCSGGHFLLEVKSD-VAQLLLDVTNDFPLGGGSERVAALGEDLHEVVCEVATG*VQ 610
           EGA GC  G     VKS  +A    +  N  P       V  L ED   VVC   T    
Sbjct: 34  EGAQGCDDGG----VKSSAMASEEREADNIVPSDSAFPEVE-LAED-DAVVCSRVT---- 83

Query: 609 TQDGVGECVSFVD---GHGVGDTVAGVQHDTGGT---TGRVQREHGLDGDVHGGRV 460
             DG GE  ++ +   G G GD  +    +  G    TG+ Q  HG D  +  GRV
Sbjct: 84  -PDGGGEVAAWCEIRRGGGDGDASSATIRNLRGEPLETGKRQSGHGSDAIIVDGRV 138


>08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,
            33643-34147,34250-34358,34436-34548,34619-34806,
            35481-36129,36169-36691,36760-36911,37042-37141,
            37301-37416
          Length = 1530

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%)
 Frame = +2

Query: 458  STRPPCTSPSKPC-SRCTRPVVPPVSCWTPATVSPTPCPS 574
            S  PPC  P  P     T P  PP+S   P    P P PS
Sbjct: 1151 SDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPS 1190


>03_05_0957 + 29195549-29196706,29198590-29198868
          Length = 478

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 25/125 (20%), Positives = 52/125 (41%)
 Frame = -1

Query: 767 AVAISCSKSRAT*HSFSLMSRTISRSAVVVNE*PRSVRIFMR*SVRSRPAKSRRRMAWGS 588
           A + S +   A       M   +  SA+  +  P + + F+   ++  P++   +     
Sbjct: 207 AASASAAGGEAARSPSEAMLHGLIHSAIHGHPVPAATKAFVAMLLKDYPSRDCVQKVLDE 266

Query: 587 AYPS*MGTVWETPSPESSTIPVVRPDAYSESTAWMATYMAGVLNVSNMIWVIFSLLALGL 408
           A+ S + TV E     +S    V  D+            + VLNV +++W+I  ++ + +
Sbjct: 267 AFLSRLETVKELMGKYASPDFRVAVDSDERDAIQRLNLQSAVLNVRHLLWLIERMVEMRV 326

Query: 407 RGASV 393
            G +V
Sbjct: 327 AGNAV 331


>03_05_0214 + 22040356-22040886
          Length = 176

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 16/40 (40%), Positives = 18/40 (45%)
 Frame = -3

Query: 573 DGHGVGDTVAGVQHDTGGTTGRVQREHGLDGDVHGGRVEC 454
           DG G G  + GV +  GG T       G  GDV GG   C
Sbjct: 131 DGGGGGRGLDGVGNGAGGATETSTSAVGDGGDVGGGGARC 170


>02_03_0132 - 15584673-15584789,15584957-15585054,15585151-15585550
          Length = 204

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 458 STRPPCTSPSK-PCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           ++ P  + PS+ P S  + P   P +  +P+  SP P P  +   SP P+
Sbjct: 31  ASTPRSSRPSESPRSGFSTPATAPRTAASPSPPSPAPSPQQQRVASPPPT 80


>02_02_0328 -
           9004670-9004753,9004873-9004947,9005031-9005132,
           9005681-9005761,9006233-9006535
          Length = 214

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 2/35 (5%)
 Frame = +2

Query: 476 TSPSKPCSRCTRPVV--PPVSCWTPATVSPTPCPS 574
           ++PS P SRC+ PV    P  CW     +  P P+
Sbjct: 20  SAPSLPASRCSLPVAASAPRRCWRLLASAEEPAPA 54


>10_06_0117 -
           10948723-10948774,10949169-10949286,10949350-10949421,
           10949772-10949866,10950183-10950322
          Length = 158

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +2

Query: 491 PCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSP 595
           P ++C   +   +  W P  +  T CPS+ DT SP
Sbjct: 110 PTAKCVGRITLDIEDWRPEVL--TVCPSSPDTDSP 142


>06_03_1205 -
           28406183-28406218,28406462-28406548,28406769-28406830,
           28407968-28408184,28408793-28408957,28409145-28409250,
           28409830-28410071,28410493-28410605,28410848-28411043,
           28411681-28411827,28412034-28412218,28412478-28412592,
           28413237-28413728
          Length = 720

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 21/64 (32%), Positives = 24/64 (37%), Gaps = 1/64 (1%)
 Frame = +3

Query: 540 LRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHR-LPHEDPHRARLLVHYHRRAGNRS*HQ 716
           LRRRC PH    + +    R P     RS P     H D H      H+H      S H 
Sbjct: 35  LRRRCAPHLPS-KPLNLAARSPLLLARRSLPFAPRAHGDHHHGH---HHHHHGHGHSHHH 90

Query: 717 GEAV 728
           G  V
Sbjct: 91  GPEV 94


>05_07_0014 - 27046329-27046371,27059170-27060017,27060739-27061563
          Length = 571

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 19/52 (36%), Positives = 24/52 (46%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           S HS+R    +PS P S  +R    PV    P  VSP+  P     H+P  S
Sbjct: 186 SSHSSRGSARTPSGPRSPSSRAPYSPVYSPYPHPVSPSYTPG----HTPVAS 233


>04_04_0633 -
           26771487-26771591,26771708-26771782,26771906-26771981,
           26772096-26772144,26772848-26773037,26773119-26773292,
           26773415-26773543
          Length = 265

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 10/16 (62%), Positives = 13/16 (81%)
 Frame = -3

Query: 615 VQTQDGVGECVSFVDG 568
           +Q+QDG GEC+ F DG
Sbjct: 228 IQSQDGAGECMLFKDG 243


>03_01_0470 +
           3619417-3619572,3619681-3619759,3620017-3620258,
           3620804-3621148,3623592-3624116
          Length = 448

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = -1

Query: 197 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 78
           WR  P +  + ARG S P + AL   +P++     +++ H
Sbjct: 251 WRRTPWVGAHAARGGSRPLRRALQGLDPVTIAAIFSTAEH 290


>02_02_0572 + 11667455-11670783,11672026-11672419
          Length = 1240

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 21/60 (35%), Positives = 25/60 (41%)
 Frame = +3

Query: 369 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRR 548
           P     PA  GS  P G  R DDPD  RN++    + R    A A    +  R   G RR
Sbjct: 95  PSSASQPAAGGSKFP-GLSRPDDPDRARNLR--LELERDAEEAAATAAPAPARDDRGRRR 151


>01_01_1044 + 8231933-8231941,8232091-8232166,8232423-8232871
          Length = 177

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 14/40 (35%), Positives = 16/40 (40%)
 Frame = +2

Query: 482 PSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           P  PCS  T    PP+ C     + P PCP       P P
Sbjct: 107 PGCPCSCSTPCSFPPIGCHDRG-ICPPPCPPPCPLPCPPP 145


>12_02_0305 - 17235832-17236379,17237345-17237444
          Length = 215

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPA-TVSPTPCPSTKDTHSPTPS 604
           PP    + P S    P   PV   +P   V+P+  P+   T  PTPS
Sbjct: 82  PPSPRRASPPSVSVEPTPAPVIAPSPPPVVAPSQPPTIAPTQPPTPS 128


>10_08_0029 + 14270945-14271364,14271449-14272486
          Length = 485

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 3/38 (7%)
 Frame = -2

Query: 250 PHLLHKSPSVPY---RPSRPDGGAFPRSRGTRREEHHL 146
           PHL    P  P+   +PSR  GG  PRS   +R   H+
Sbjct: 380 PHLPQPPPPPPHFERQPSRRRGGGVPRSVKMQRSSSHV 417


>07_03_0934 + 22735352-22735405,22736512-22736566,22737054-22737607
          Length = 220

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 27/82 (32%), Positives = 34/82 (41%), Gaps = 11/82 (13%)
 Frame = +3

Query: 576 RRIRTPPRHPASGLSRSRPHRLPHED-PHRARLLVH-YHRRAGNRS*---------HQGE 722
           RR     R    G  R   H L H+    RARLL H  H RA  R           H G+
Sbjct: 45  RRAGGGRRDARIGALRGAVHELQHQHVDRRARLLTHPEHLRAAVREQEELVLVRHRHGGD 104

Query: 723 AVLRRS*LRAGNGHRCIQQLPR 788
            V   +  R G+ HRC+++  R
Sbjct: 105 VVDHDALQRMGHLHRCVKETLR 126


>06_01_0486 - 3455030-3455770
          Length = 246

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 2/48 (4%)
 Frame = +2

Query: 467 PPCTSPSKP--CSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP T P  P      T P VPP +  +P    P P P +   + P PS
Sbjct: 105 PPPTPPYVPPYIPPPTPPYVPPPTPPSPPPYVPPPTPPSPPPYVPPPS 152


>04_04_0040 + 22322839-22324173
          Length = 444

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 12/40 (30%), Positives = 17/40 (42%)
 Frame = +2

Query: 488 KPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           KPC  C +   P     + +T +  PC S   +  PT  C
Sbjct: 124 KPCVDCFKQSTPVFDPSSSSTYATVPCSSASCSDLPTSKC 163


>03_06_0331 -
           33181757-33181795,33182325-33182453,33182941-33182967,
           33183459-33183545,33183827-33183975,33185467-33185521,
           33185596-33187584,33188705-33188782
          Length = 850

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +3

Query: 405 PQPQGQQREDDPDHVRNIQH 464
           P    Q+  DDPDHV+N+ H
Sbjct: 393 PHETNQEDLDDPDHVKNLLH 412


>03_01_0182 -
           1466097-1466147,1466197-1466331,1466659-1466777,
           1467005-1467064,1467206-1467296,1467767-1467955,
           1469310-1469393,1469540-1469701,1469790-1469933,
           1470053-1470247
          Length = 409

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 26/85 (30%), Positives = 35/85 (41%), Gaps = 2/85 (2%)
 Frame = -3

Query: 765 GGHFLLEVKSDVAQLLLDVTNDFPLGGGSERVAALGEDLHEVV--CEVATG*VQTQDGVG 592
           G HF  E      +LLL+  N+  +      + A GE   E+V   +   G     DG+ 
Sbjct: 73  GDHFSEEEAEATLRLLLEEENEARIAAFLVLLRAKGETYEEIVGLAKAMIGCCVRVDGLD 132

Query: 591 ECVSFVDGHGVGDTVAGVQHDTGGT 517
           + V  V G G GD    V   TG T
Sbjct: 133 DAVDIV-GTG-GDGADTVNISTGST 155


>02_04_0179 +
           20682852-20684510,20684593-20684661,20684741-20684809,
           20686779-20688206
          Length = 1074

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 16/37 (43%), Positives = 17/37 (45%)
 Frame = -2

Query: 250 PHLLHKSPSVPYRPSRPDGGAFPRSRGTRREEHHLLR 140
           P    K P  P  P  PD  A  RSR TRR    +LR
Sbjct: 212 PDEASKLPPPPAPPPAPDDDAASRSRSTRRRLVKVLR 248


>01_06_0365 + 28767538-28767696,28768299-28768520,28768630-28768868,
            28769499-28770024,28770115-28770388,28770495-28771134,
            28771220-28771448,28771682-28771948,28772031-28772294,
            28772700-28773344
          Length = 1154

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 15/57 (26%), Positives = 29/57 (50%)
 Frame = +1

Query: 430  KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHA 600
            ++  + F+  + P + V     L +  SG+T  +V +SG G S  + + E +  PH+
Sbjct: 912  ELNHVNFKYPSRPDVQVLCDFTLGI-PSGKTVALVGESGSGKSTVIALLERFYDPHS 967


>10_07_0154 +
           13487971-13488168,13488259-13488483,13488592-13490492,
           13490578-13490829,13491110-13491191,13491466-13491657
          Length = 949

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 5/51 (9%)
 Frame = +2

Query: 464 RPPCTSPSKPCSRCTRPVVP---PV--SCWTPATVSPTPCPSTKDTHSPTP 601
           R P   P+ P S   +P +P   PV  S  +PA     P PS+  T  PTP
Sbjct: 553 RSPPRQPTPPPSPSQQPPLPAPQPVQASPTSPAKQHAPPAPSSVQTSPPTP 603


>09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817
          Length = 883

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 15/49 (30%), Positives = 19/49 (38%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           H+T  P    +     C   + PP+    PA   P   P T  T  PTP
Sbjct: 418 HATTAPLALRAPAPHLCVSRMPPPLVPTPPAHAPPVATPPTLATPVPTP 466


>08_02_1615 + 28257275-28258428,28258523-28259144
          Length = 591

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 25/84 (29%), Positives = 39/84 (46%)
 Frame = +1

Query: 406 LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY 585
           L     R ++  + F   + P + +     LS+ A G+T  +V  SG G S  V + E +
Sbjct: 425 LEAVTGRVELRDVEFSYPSRPDVGILRGLSLSVPA-GKTIALVGSSGSGKSTVVSLIERF 483

Query: 586 ALPHAILRLDLAGRDLTDYLMKIL 657
             P+A   L L G DL D  ++ L
Sbjct: 484 YEPNAGTIL-LDGHDLRDLNLRWL 506


>08_01_1006 -
           10191817-10191822,10192449-10192745,10192826-10192975,
           10194558-10195370
          Length = 421

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -1

Query: 224 CPIPTITP*WRGLPTIEGNTARGASSPAK 138
           C +P   P +RG P++   T RG + PA+
Sbjct: 142 CDMPLAPPGFRGFPSLVSLTLRGVTLPAE 170


>07_01_0766 -
           5885207-5885791,5885874-5886224,5886252-5886269,
           5886339-5886541,5886632-5886890,5887052-5887264,
           5887357-5887482,5887590-5887727,5887817-5888162,
           5888254-5888520,5888983-5889172,5889264-5889363,
           5889444-5889694,5889990-5890182,5890313-5890336
          Length = 1087

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 1/61 (1%)
 Frame = +3

Query: 360 ACRPRGTPSPAH*GSPQPQGQQRED-DPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRA 536
           AC    T    H GSP  +G++ ED D D V +  +         + +A R+RS+ R  A
Sbjct: 60  ACPQCKTKYKRHKGSPAIRGEEGEDTDADDVSDYNYPASGSADQKQKIADRMRSW-RMNA 118

Query: 537 G 539
           G
Sbjct: 119 G 119


>06_03_1155 - 28065126-28065139,28065268-28065324,28065571-28066312
          Length = 270

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +2

Query: 476 TSPSKPCSRCTRPVVPPVSCWTPATVSPTP 565
           T P +  S C  P VPP+   +P+  +P P
Sbjct: 237 TVPLQTFSMCNTPSVPPLMPQSPSAAAPAP 266


>06_01_0672 -
           4903126-4903219,4903322-4903430,4903620-4905096,
           4906200-4906538
          Length = 672

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +3

Query: 507 RVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRA 665
           R+R+  R R+ L+      R   RR   PPR    G +  RP + P E  H A
Sbjct: 206 RLRALSRSRSSLKESASSVRDSPRRAPPPPRRSHDGDAGDRPKQQP-EPVHAA 257


>06_01_0121 - 932334-933074,933189-933272,934602-935006
          Length = 409

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 10/16 (62%), Positives = 11/16 (68%)
 Frame = -2

Query: 511 TRTARARLGWRRTWRA 464
           TR  R R+GWRR W A
Sbjct: 103 TRGGRGRVGWRRQWSA 118


>03_06_0030 + 31161821-31161927,31163700-31163934,31164064-31164826,
            31165816-31167650,31169294-31169424,31169993-31170075,
            31170426-31170680,31171125-31171220,31171695-31171775,
            31171811-31171968,31172434-31172534,31172614-31172629,
            31173390-31173439,31174558-31174588,31175156-31175305,
            31176135-31176173,31176288-31176410,31176496-31176552,
            31176837-31176911,31177003-31177107
          Length = 1496

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 4/33 (12%)
 Frame = -2

Query: 208  SRPDGGA---FPRSRGTRREEHHL-LRNRPCTY 122
            S+ D GA   +P+  GT R+  H+ ++NRPC +
Sbjct: 1333 SKADAGASKTYPQQAGTIRKNGHIVIKNRPCKW 1365


>03_05_0780 +
           27646936-27647084,27647168-27647289,27649380-27649458,
           27650346-27650427,27650483-27650600,27650695-27651050,
           27651404-27652222,27652846-27653265,27653426-27653437
          Length = 718

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 3/44 (6%)
 Frame = +2

Query: 476 TSPSKP--CSRCTRPVVPPVSCWTPATVSPTPCPST-KDTHSPT 598
           T P+ P    RC+    P  +C TPA   P   PS+ +D  +PT
Sbjct: 323 TPPANPRLTHRCSTTTQPLPTCGTPAPAPPAGQPSSAEDRATPT 366


>03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093
          Length = 435

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = -2

Query: 235 KSPSVPYRPSRPDGGAFPR 179
           + P+V +RP+ PDGGA P+
Sbjct: 207 RCPTVQHRPTPPDGGAPPK 225


>03_05_0267 - 22538631-22539452
          Length = 273

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCWTPATV 553
           T PP +SPS+ CS       PPV  W   +V
Sbjct: 199 TSPPSSSPSRGCSARRPTPSPPVLGWVIPSV 229


>03_02_0811 + 11437654-11438958
          Length = 434

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 14/40 (35%), Positives = 18/40 (45%)
 Frame = +2

Query: 488 KPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           +PC  C    +P     T +T+S T C ST     P  SC
Sbjct: 111 QPCPACFDQALPYFDPSTSSTLSLTSCDSTLCQGLPVASC 150


>03_02_0809 + 11419318-11420493
          Length = 391

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 14/40 (35%), Positives = 18/40 (45%)
 Frame = +2

Query: 488 KPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           +PC  C    +P     T +T+S T C ST     P  SC
Sbjct: 64  QPCPACFDQALPYFDPSTSSTLSLTSCDSTLCQGLPVASC 103


>03_02_0308 -
           7297228-7298008,7298495-7298576,7298612-7298669,
           7298723-7298835,7298924-7299034,7299480-7299597,
           7299706-7299809,7300570-7300665,7301806-7302307
          Length = 654

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = +2

Query: 482 PSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           PS+  SR T P+ PP   W P      P P+    HS +P
Sbjct: 434 PSESVSRFTTPLTPPPMPWGP------PRPANMARHSSSP 467


>03_01_0515 - 3864796-3865425
          Length = 209

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 15/50 (30%), Positives = 21/50 (42%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           PP  + S P      P  PP +  +P    P+P P +    SP P   W+
Sbjct: 76  PPSVTSSPPPPPLPPPPPPPAA--SPPPPPPSPPPPSPVKSSPPPPPAWS 123


>02_01_0302 - 2021221-2023305
          Length = 694

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 4/54 (7%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPC--SRCTRPVV--PPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           H + P  T+PS P   S  T P    PP    TP+  SP    +   +HSP  S
Sbjct: 483 HPSPPGSTTPSYPSPPSSSTTPSYHSPPQGHTTPSHPSPPSSSTAPPSHSPPQS 536


>01_07_0021 -
           40533864-40534583,40534779-40534814,40534909-40535048,
           40535837-40535922,40536430-40536653,40536770-40536865,
           40538766-40538833,40539945-40540055,40540799-40540955
          Length = 545

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 18/51 (35%), Positives = 21/51 (41%)
 Frame = +2

Query: 452 KHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           +H   P  TSP  P +    PV PP     P T S  P PS      P P+
Sbjct: 435 EHPPPPESTSPPPPPTSDPPPVPPP----PPTTGSFMPIPSAPFAGLPVPA 481


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,694,563
Number of Sequences: 37544
Number of extensions: 685810
Number of successful extensions: 3261
Number of sequences better than 10.0: 94
Number of HSP's better than 10.0 without gapping: 2797
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3203
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2127163404
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).