SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0019
         (837 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0348 - 3076395-3078236                                           31   1.5  
02_01_0084 - 573638-574305,574705-574900,574997-577246,578053-57...    29   3.5  
01_06_1556 - 38222071-38222708,38222795-38222822,38222950-382230...    29   6.1  
10_07_0019 + 11931519-11932310                                         28   8.0  

>08_01_0348 - 3076395-3078236
          Length = 613

 Score = 30.7 bits (66), Expect = 1.5
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 4/64 (6%)
 Frame = -2

Query: 371 ITSWSFTMGKLSSTKRVQVSRKN--SLPLQLTI--NFMVSGFTLRISLKRVSFWFLPGPK 204
           + SW+  +  LS +  V+ ++    ++P++ ++  N MVSGF     +     WF   P+
Sbjct: 111 VVSWNTMVSGLSKSGAVEEAKAVFLAMPVRNSVSWNAMVSGFACSRDMSAAEEWFRNAPE 170

Query: 203 KGSS 192
           KG +
Sbjct: 171 KGDA 174


>02_01_0084 - 573638-574305,574705-574900,574997-577246,578053-579174,
            579266-579370,579975-580028,580244-580344,580454-581423,
            582030-582203,582341-582643,582719-582856,582993-583247,
            584230-584370,585008-585289,585395-585540,585627-585690,
            585723-585799,586285-586301,587728-587867,587972-588029,
            588121-588218,588727-588776,589260-589743
          Length = 2630

 Score = 29.5 bits (63), Expect = 3.5
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +1

Query: 79   KYYKNLGCLIKNAKRKKHLVEHEQE-EKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEI 249
            K+  N+   +   KRK+ LVE+ QE EK     D+ +  ED F    + +  T+++++
Sbjct: 2330 KHTSNVLSKVHEQKRKQLLVEYNQEMEKLKQKYDSLLQKEDSFYAQKEAELDTIYRKV 2387


>01_06_1556 -
           38222071-38222708,38222795-38222822,38222950-38223070,
           38223206-38223318,38223424-38223506,38223868-38223930,
           38224100-38224254,38224411-38224580,38225101-38225189,
           38225304-38225496,38225655-38225779,38226069-38226475,
           38226855-38226919,38227414-38227692,38227772-38227845,
           38228241-38228292,38228366-38228473,38228871-38228972,
           38229100-38229173,38229262-38229435,38229667-38229771,
           38229867-38229977,38230364-38230487
          Length = 1150

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 14/65 (21%), Positives = 28/65 (43%)
 Frame = +1

Query: 127 KHLVEHEQEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEIRSVKPDTMKLIVNWSGKEF 306
           K +   +Q + +W  +D+ +     F   G    L  F++ +    D  + +V W G ++
Sbjct: 426 KEVYSEDQRKLEWFEVDHAIACRRKFHHEGLCDVLATFQDNQDF--DGYEFLVKWKGLDY 483

Query: 307 LRETW 321
              TW
Sbjct: 484 CEATW 488


>10_07_0019 + 11931519-11932310
          Length = 263

 Score = 28.3 bits (60), Expect = 8.0
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -3

Query: 655 RCKRWVCRSSPI*RG 611
           RC+RW CRS P  RG
Sbjct: 39  RCRRWWCRSEPTSRG 53


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,511,533
Number of Sequences: 37544
Number of extensions: 514856
Number of successful extensions: 1318
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1257
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1317
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2315199948
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).