SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0018
         (929 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_05_0674 - 24187820-24188713,24188809-24189204                       31   1.7  
12_01_0461 + 3618414-3618782,3619664-3619794,3620177-3620294,362...    29   7.0  

>01_05_0674 - 24187820-24188713,24188809-24189204
          Length = 429

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 500 PPPATSYLWAKSNKSRISTRH 562
           PPPA S+ WAK  +SR +T H
Sbjct: 170 PPPAPSHQWAKIKRSRHATDH 190


>12_01_0461 +
           3618414-3618782,3619664-3619794,3620177-3620294,
           3620602-3620654,3620758-3620807,3620912-3621010,
           3621511-3621620,3621773-3621900,3622071-3622161,
           3622610-3622693,3622863-3623083,3623449-3623527,
           3624134-3624283,3624326-3624470,3624604-3624983,
           3625096-3625197
          Length = 769

 Score = 28.7 bits (61), Expect = 7.0
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +1

Query: 493 LGPSSSNLIPLGQIKQEPDLHTPSRRRAKLKPDLKLKVSVCKVLSACSYFHTQ 651
           +GP S  ++ L ++    DL  P      L P L   V  C++ ++  YF  Q
Sbjct: 430 IGPHSEYMVKLHRLPWALDLGHPGHGPGGLGPGLSAPVGECRLDASWPYFFVQ 482


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,111,169
Number of Sequences: 37544
Number of extensions: 533325
Number of successful extensions: 1062
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1043
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1062
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2659245980
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).