SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0016
         (985 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093...    33   0.26 
10_08_0928 + 21617977-21618157,21618260-21618378,21618653-216187...    33   0.35 
09_06_0087 + 20771329-20771450,20771462-20771771,20771893-207726...    32   0.81 
11_06_0291 + 22008412-22012284                                         30   2.5  
06_01_0584 - 4178391-4178732,4178854-4178915,4180361-4180481,418...    30   3.3  
04_04_0683 - 27234137-27234486,27234645-27234756,27234889-272349...    30   3.3  
03_01_0009 - 89127-89924,90090-90518,90582-90716,91102-91382,916...    30   3.3  
05_07_0112 - 27755604-27756449,27756624-27756887,27757428-277575...    29   4.3  
03_02_0924 + 12429764-12430120,12430562-12430637,12430803-124308...    29   4.3  
11_03_0201 + 11578163-11578915                                         29   5.7  
01_06_0133 - 26793335-26793380,26793696-26793907,26794009-267941...    29   5.7  
05_01_0554 + 4856131-4856605,4858051-4858098,4860611-4860792,486...    29   7.5  
01_06_0836 - 32321431-32321556,32321656-32321872,32321975-323235...    29   7.5  
12_02_0410 + 18701258-18701327,18701398-18701630,18701782-187026...    28   9.9  
01_06_0864 - 32546696-32546803,32546881-32546961,32547134-325472...    28   9.9  

>01_06_1670 -
           39007402-39008229,39008320-39008567,39009159-39009364,
           39009454-39011054
          Length = 960

 Score = 33.5 bits (73), Expect = 0.26
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = +2

Query: 608 SAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPP 721
           S   PS  L  N  AL+++ T D  TT+P  P VQ PP
Sbjct: 379 SPSPPSSPLIENTSALRSTTTTD--TTIPRNPFVQPPP 414


>10_08_0928 +
           21617977-21618157,21618260-21618378,21618653-21618774,
           21618853-21619049,21619350-21619603,21619779-21619880,
           21619976-21620404,21620611-21621369,21621586-21621771
          Length = 782

 Score = 33.1 bits (72), Expect = 0.35
 Identities = 22/92 (23%), Positives = 46/92 (50%), Gaps = 1/92 (1%)
 Frame = +2

Query: 602 YLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTP-PLQEPAINETTRRTPKDDLS 778
           YL+  T +   D+N+ +  AS      T  P+  ++    P+    + E       DD++
Sbjct: 240 YLTESTSASVGDNNSNSPCASGQ----TPRPSNVLISDKAPMTSSPLQELMLSEDMDDVN 295

Query: 779 NDIETLLVEIRDVQTRLTDLPDESLEATEEVS 874
           +++E L +E+R ++     + DES+ A++ V+
Sbjct: 296 SELEKLRLELRHIKGVCKLVQDESINASQHVT 327


>09_06_0087 +
           20771329-20771450,20771462-20771771,20771893-20772672,
           20772854-20774002
          Length = 786

 Score = 31.9 bits (69), Expect = 0.81
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 3/63 (4%)
 Frame = +2

Query: 701 PVVQTPPLQEPAINETTRRTP--KDDLSNDIETLLVEIRD-VQTRLTDLPDESLEATEEV 871
           PV++ P + EP +++T    P  K  LS D+   ++E+ D VQ  L   PD+      E 
Sbjct: 327 PVMEDPDIHEPLVSQTPPAPPIEKRCLSFDLLIHVLEVVDPVQQLLDSPPDDPYNDDREA 386

Query: 872 SRR 880
            RR
Sbjct: 387 LRR 389


>11_06_0291 + 22008412-22012284
          Length = 1290

 Score = 30.3 bits (65), Expect = 2.5
 Identities = 20/74 (27%), Positives = 37/74 (50%)
 Frame = +2

Query: 251 KQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHDAECQYFLSMAKKSKPTSAVG 430
           +Q+Q   K +D+    +   D  NI    +  ++KH+  D E    +S+ K++      G
Sbjct: 352 QQDQANNKAVDMYKLPEWNYD--NIMKIARK-LKKHMEADEELNEQISVEKRTTKQGGGG 408

Query: 431 DDFEVKDQNDKDRD 472
           ++ E KD+ D DR+
Sbjct: 409 ENKEEKDKGDGDRE 422


>06_01_0584 - 4178391-4178732,4178854-4178915,4180361-4180481,
            4180592-4180732,4180830-4180959,4182306-4182436,
            4182528-4182601,4182680-4182741,4183135-4183209,
            4184658-4184760,4184835-4184991,4185549-4185743,
            4186204-4186282,4186697-4186806,4187249-4187374,
            4187475-4187541,4187622-4187791,4187880-4188018,
            4188361-4188522,4188672-4188772,4188852-4188994,
            4189438-4189537,4190364-4190414,4191062-4191169,
            4191279-4191494,4191585-4191721,4191820-4191915,
            4192017-4192234,4192764-4192925,4193006-4193163,
            4194221-4194379
          Length = 1364

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +2

Query: 599  SYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQ-TPPLQEPAINETTRRTP 763
            S+ +  TP + +  +A + + ++ +D  T +P+    + TPP+Q+P I       P
Sbjct: 1297 SHENGTTPKEEVMLDASSKETTSPKDPATEVPSSASKEATPPVQDPVIEAVKEEPP 1352


>04_04_0683 -
           27234137-27234486,27234645-27234756,27234889-27234961,
           27235071-27235491,27236148-27236403
          Length = 403

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 17/75 (22%), Positives = 41/75 (54%)
 Frame = +2

Query: 590 DHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKD 769
           D+ SY+++E+ S S+       +A++ ++++T  P + +VQT      A   T  +   +
Sbjct: 179 DNKSYITSESYSGSVSFVYSESKATSNQNVITEQPKKFLVQTSDNARRANLHTENQDTLE 238

Query: 770 DLSNDIETLLVEIRD 814
           + ++ + +L +E +D
Sbjct: 239 NANSPLVSLHMEGKD 253


>03_01_0009 -
           89127-89924,90090-90518,90582-90716,91102-91382,
           91634-91809,91899-92011,92157-92278,92375-92594
          Length = 757

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 23/92 (25%), Positives = 47/92 (51%)
 Frame = +2

Query: 602 YLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSN 781
           YL+  T S   D +     ++ TE   ++ P+E       L++ ++ +      KD +S 
Sbjct: 254 YLNGST-SIYPDKDRRVNSSTGTE---SSKPSELKGSNEVLRQESLLQGMLSDNKDHIST 309

Query: 782 DIETLLVEIRDVQTRLTDLPDESLEATEEVSR 877
           ++E L +E+R +Q +   + DES +A+ + S+
Sbjct: 310 ELEKLRLELRLIQGKHKLVQDESDDASRQASK 341


>05_07_0112 - 27755604-27756449,27756624-27756887,27757428-27757532,
            27757626-27758249,27759048-27759596,27759665-27760372,
            27760449-27760658,27761266-27761421,27761524-27761664,
            27762015-27762101,27762209-27762309,27763071-27763293,
            27763384-27763548,27763621-27763713,27763801-27764292,
            27764729-27764805,27765184-27765681,27765818-27766046
          Length = 1855

 Score = 29.5 bits (63), Expect = 4.3
 Identities = 29/126 (23%), Positives = 52/126 (41%), Gaps = 3/126 (2%)
 Frame = +2

Query: 587  KDHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPK 766
            K   S L   T S + +++  A  +  ++    T P+   V+TP  ++PA +E      +
Sbjct: 822  KIQKSGLRDLTTSKTPEASISAALSRDSKLFERTAPSTYCVKTPYRKDPADSEAVLAAAR 881

Query: 767  DDL---SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDH 937
            + +    N I       +DV     D   E  +A ++    E N  +    +  V A+D 
Sbjct: 882  EKIRVFQNTISECEEVEKDVDDAERDEDSECDDADDDPDGDEVNIEEKDVKTSLVKAQDG 941

Query: 938  GVPPEV 955
            G+P  V
Sbjct: 942  GMPTAV 947


>03_02_0924 +
           12429764-12430120,12430562-12430637,12430803-12430849,
           12431850-12431962,12432056-12432129,12432258-12432353,
           12432440-12432559,12432660-12432893,12433486-12433634,
           12434145-12434301,12434387-12434542,12435359-12435735,
           12435871-12436020,12437071-12437253,12437440-12437643,
           12437869-12437975,12438253-12438406,12438796-12438917,
           12439541-12439787
          Length = 1040

 Score = 29.5 bits (63), Expect = 4.3
 Identities = 15/39 (38%), Positives = 24/39 (61%)
 Frame = +3

Query: 327 VTITNSGLKNIYTMTPNANISFQWPKNLNQHQPLEMILK 443
           + +T+SGLKN+Y +    +  +Q+ K L Q +P E I K
Sbjct: 413 IRLTDSGLKNLYEV---ISAVYQYIKLLKQSEPQEWIFK 448


>11_03_0201 + 11578163-11578915
          Length = 250

 Score = 29.1 bits (62), Expect = 5.7
 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 3/39 (7%)
 Frame = -3

Query: 665 RKLEEPPRLNQANQKEF---RRSSKSYDLSNYIYRRVSP 558
           R + E  R+ Q+ QK +   RR   ++++ +Y+Y RV+P
Sbjct: 73  RTIRERLRIAQSRQKSYTDNRRRELTFEVGDYVYLRVTP 111


>01_06_0133 -
           26793335-26793380,26793696-26793907,26794009-26794134,
           26794258-26794335,26794857-26795014,26795230-26795278,
           26795369-26795414,26795527-26795654,26796154-26796237,
           26796317-26796409,26796505-26796549,26796792-26796851
          Length = 374

 Score = 29.1 bits (62), Expect = 5.7
 Identities = 18/69 (26%), Positives = 34/69 (49%)
 Frame = +2

Query: 761 PKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHG 940
           P   +  D+ T   + R + T +T++P +  + ++   R++SN    RRS     AE   
Sbjct: 194 PVTAIKPDVSTAS-DFRVIATPVTEVPTKDDKESKRERRKQSNRESARRSRLRKQAETEE 252

Query: 941 VPPEVEVQT 967
           +  +VE+ T
Sbjct: 253 LARKVELLT 261


>05_01_0554 +
           4856131-4856605,4858051-4858098,4860611-4860792,
           4861409-4863136
          Length = 810

 Score = 28.7 bits (61), Expect = 7.5
 Identities = 12/34 (35%), Positives = 23/34 (67%)
 Frame = +2

Query: 11  KSNKIETSGIIENVEREETIEPELSDTLSDAVPI 112
           K++++E+ G+  NVE ++    E+++  S AVPI
Sbjct: 433 KASRLESEGVEVNVELQKEEATEVNEARSQAVPI 466


>01_06_0836 -
           32321431-32321556,32321656-32321872,32321975-32323590,
           32323670-32323753,32323834-32324104,32324294-32324547,
           32324709-32324918,32325839-32326024
          Length = 987

 Score = 28.7 bits (61), Expect = 7.5
 Identities = 14/52 (26%), Positives = 27/52 (51%)
 Frame = +2

Query: 767 DDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAV 922
           + +++  E +  ++  V   L  L DE  EAT E  RRE   ++++ +  A+
Sbjct: 646 EHINSQKEMINTKLEHVAVELQKLKDERKEATLERERREQELSEIKGTIEAL 697


>12_02_0410 +
           18701258-18701327,18701398-18701630,18701782-18702639,
           18703006-18703865,18704285-18704395,18704486-18704567,
           18704643-18704735,18704795-18704989
          Length = 833

 Score = 28.3 bits (60), Expect = 9.9
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = +2

Query: 617 TPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPA 736
           TPS S+ + A A  A  +  I TTLP  P+ Q  PL+ P+
Sbjct: 436 TPSPSVPNTA-APPAPLSPLICTTLPGSPLPQISPLRGPS 474


>01_06_0864 -
           32546696-32546803,32546881-32546961,32547134-32547250,
           32548264-32548338,32548618-32548680,32549122-32549187,
           32549254-32549325,32549403-32549504,32549588-32549765,
           32549871-32549926,32551578-32551688,32551797-32551865,
           32551960-32552068,32552176-32552327,32552398-32552475,
           32554257-32554379,32555527-32555646,32555729-32555809,
           32555881-32556027,32556112-32556190,32557223-32557297,
           32558004-32558113,32558984-32559082,32559700-32559815,
           32559914-32560022,32560098-32560229,32560389-32560591,
           32561428-32561585,32561668-32561797,32562529-32562607,
           32562806-32562829
          Length = 1073

 Score = 28.3 bits (60), Expect = 9.9
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +2

Query: 281 DLNLKTDVKVDIENIRNDNKFWVEKHLYHDAE 376
           D+    D  V++E +  DNK+  EKH   DA+
Sbjct: 289 DVYASFDKYVEVERLEGDNKYQSEKHGLQDAK 320


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,395,599
Number of Sequences: 37544
Number of extensions: 425193
Number of successful extensions: 1470
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 1387
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1469
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2870111300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).