SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0015
         (721 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_01_0759 + 5838726-5838879,5839654-5839778,5840168-5840264,584...   107   9e-24
03_06_0688 - 35559239-35559433,35560455-35560792,35561357-355617...   103   1e-22
01_06_0169 - 27172182-27172361,27172552-27172889,27172983-271734...    97   9e-21
05_07_0137 + 27955876-27956000,27957626-27957714,27957963-279580...    95   4e-20
01_05_0779 + 25128320-25128518,25129048-25129141,25129867-251300...    87   1e-17
05_02_0085 - 6465126-6466049                                           69   3e-12
01_06_1240 - 35654671-35654805,35654887-35655040,35655254-356553...    52   6e-07
05_06_0056 + 25246631-25246913,25247047-25247141,25247593-252476...    50   2e-06
02_05_1068 + 33862378-33863640                                         32   0.53 
06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797     30   1.6  
05_05_0152 + 22762994-22763326,22763857-22763989,22764281-227643...    30   1.6  
05_04_0179 + 18784011-18784240,18785035-18785119,18785905-187861...    29   2.8  
02_05_0312 - 27792127-27792360,27793282-27793412,27793534-27793837     29   2.8  
11_07_0002 - 27171791-27172222                                         29   3.7  
10_06_0132 + 11073057-11073345,11073899-11073903,11074358-110744...    29   3.7  
09_02_0279 + 6702517-6702948                                           29   3.7  
02_01_0302 - 2021221-2023305                                           29   3.7  
11_06_0118 + 20308921-20309204,20310559-20310700                       28   6.5  
04_04_0640 - 26891552-26891725,26891814-26892326,26892698-268936...    28   6.5  
03_06_0744 + 35910512-35910569,35911145-35911325,35912332-359124...    28   6.5  
09_06_0328 + 22365308-22365415,22365743-22366018,22366166-223664...    28   8.6  
08_02_0113 - 12715888-12716181,12717443-12717602,12718327-127183...    28   8.6  
03_05_0168 - 21466431-21466445,21467053-21467160,21467222-214673...    28   8.6  
01_06_1731 + 39516897-39517632,39517744-39517912,39517985-395184...    28   8.6  
01_03_0068 - 12188426-12188767                                         28   8.6  
01_01_0570 - 4231100-4232560                                           28   8.6  

>07_01_0759 +
           5838726-5838879,5839654-5839778,5840168-5840264,
           5840948-5841421,5842017-5842354,5843039-5843197,
           5843273-5843311
          Length = 461

 Score =  107 bits (257), Expect = 9e-24
 Identities = 51/112 (45%), Positives = 76/112 (67%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+C  + +V+DLDETLVHS+ +P  +A F  PV  +   H +YV  RP++ EFL R   
Sbjct: 270 TRSCPTTTLVLDLDETLVHSTLEPCEDADFAFPVYFNFREHTIYVRCRPYLKEFLERVAN 329

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           L+  ++FTAS + YA+ + ++LD +  +FR R++RDSCV+  GNY+KDL  L
Sbjct: 330 LFETIIFTASQSIYAEQLLNVLDPKRKLFRHRVYRDSCVYVEGNYLKDLTVL 381


>03_06_0688 -
           35559239-35559433,35560455-35560792,35561357-35561785,
           35562014-35562110,35562314-35562438,35562758-35562908
          Length = 444

 Score =  103 bits (248), Expect = 1e-22
 Identities = 47/112 (41%), Positives = 77/112 (68%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+C ++ +V+DLDETLVHS+ +P  ++ F  PV  +   H +YV  RP++ EFL     
Sbjct: 254 TRSCPRTTLVLDLDETLVHSTLEPCEDSDFTFPVHFNLREHTIYVRCRPYLKEFLETVAS 313

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           ++  ++FTAS + YA+ + ++LD +  +FR R++R+SC+F  GNY+KDL+ L
Sbjct: 314 MFEIIIFTASQSIYAEQLLNILDPKRRLFRHRVYRESCLFVEGNYLKDLSVL 365


>01_06_0169 -
           27172182-27172361,27172552-27172889,27172983-27173426,
           27174731-27174836,27175401-27175495,27175802-27175958
          Length = 439

 Score = 97.5 bits (232), Expect = 9e-21
 Identities = 49/104 (47%), Positives = 67/104 (64%), Gaps = 1/104 (0%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVHS+ +  ++  F  PV  D   H VYV KRPH+  FL++  E++  V
Sbjct: 259 KVTLVLDLDETLVHSTTEQCDDYDFTFPVFFDMKEHMVYVRKRPHLHMFLQKMAEMFEVV 318

Query: 584 LFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDL 712
           +FTAS + YAD + D+LD    +F  R FR+SCVF   +Y KDL
Sbjct: 319 IFTASQSVYADQLLDILDPEKKLFSRRYFRESCVFTNTSYTKDL 362


>05_07_0137 +
           27955876-27956000,27957626-27957714,27957963-27958054,
           27959338-27959419,27960038-27960454,27960539-27960876,
           27961066-27961233
          Length = 436

 Score = 95.5 bits (227), Expect = 4e-20
 Identities = 49/101 (48%), Positives = 67/101 (66%), Gaps = 1/101 (0%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLDETL+HSS    + A F  P+      H VYV KRPHVD FL++  E++  V+FT
Sbjct: 263 LVLDLDETLIHSSAVDRDGADFSFPMYHGLKEHTVYVKKRPHVDTFLQKVSEMFKVVIFT 322

Query: 593 ASLAKYADPVADLLDRWGV-FRARLFRDSCVFHRGNYVKDL 712
           ASL+ YA+ + D+LD   + F  R FRDSC+   G+Y+KDL
Sbjct: 323 ASLSSYANRLLDMLDPKNIFFTKRYFRDSCLPVDGSYLKDL 363


>01_05_0779 +
           25128320-25128518,25129048-25129141,25129867-25130078,
           25130924-25131054,25131933-25132041,25132180-25132659,
           25133194-25133531,25133810-25133977
          Length = 576

 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 44/104 (42%), Positives = 64/104 (61%), Gaps = 1/104 (0%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLDETLVHS+    +N  F + V  +   H VYV +RPH+  FL +  +++  V+FT
Sbjct: 403 LVLDLDETLVHSTLDHCDNVDFTLQVFFNMKNHTVYVRQRPHLKMFLEKVAQMFDLVIFT 462

Query: 593 ASLAKYADPVADLLDRWG-VFRARLFRDSCVFHRGNYVKDLNSL 721
           AS   YA+ + D LD  G +   R++R+SC+F  G Y KDL  L
Sbjct: 463 ASQRIYAEQLIDRLDPDGRLISHRIYRESCIFSEGCYTKDLTIL 506


>05_02_0085 - 6465126-6466049
          Length = 307

 Score = 69.3 bits (162), Expect = 3e-12
 Identities = 45/107 (42%), Positives = 56/107 (52%), Gaps = 4/107 (3%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAH--FVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY* 577
           +  + +DLDETL+HS   P   A   F V   I G     YV+KRP VD FL      + 
Sbjct: 129 RRTLFLDLDETLIHSQTDPAARARHDFAVRPVIAGQAVTFYVVKRPGVDAFLAAAAAAFE 188

Query: 578 CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSC-VFHRGNYVKDL 712
            V+FTA L +YA  V D LD R  +F  RL+R +C     G  VKDL
Sbjct: 189 LVVFTAGLPEYASLVLDRLDPRGALFAHRLYRGACRDAGDGRLVKDL 235


>01_06_1240 -
           35654671-35654805,35654887-35655040,35655254-35655335,
           35655413-35655533,35655622-35655750,35656116-35656136,
           35656655-35656972
          Length = 319

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 31/77 (40%), Positives = 43/77 (55%), Gaps = 1/77 (1%)
 Frame = +2

Query: 488 VEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLF 667
           VE    V+ V V +RP + EFL++  E    +LFTA L  YA P+ D +D    F+ RL+
Sbjct: 158 VEGRNKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYARPLVDRIDVHNRFKLRLY 217

Query: 668 RDSCV-FHRGNYVKDLN 715
           R S V      +VKDL+
Sbjct: 218 RPSTVTTEYREHVKDLS 234


>05_06_0056 +
           25246631-25246913,25247047-25247141,25247593-25247629,
           25248158-25248219,25248305-25248418,25249248-25249352,
           25249441-25249539,25250203-25250359,25250473-25250579
          Length = 352

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/65 (35%), Positives = 35/65 (53%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP VD F+   G+ Y  V+++  +  Y DPV + LD  G    RL R +  +  G + +
Sbjct: 206 KRPGVDAFIEHMGKFYEVVVYSDQMPMYVDPVLERLDTKGFITGRLSRPATKYQDGKHYR 265

Query: 707 DLNSL 721
           DL+ L
Sbjct: 266 DLSKL 270


>02_05_1068 + 33862378-33863640
          Length = 420

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 12/95 (12%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSS-FKPINNAH----FVVPVEIDGA-------VHQVYVLKRPHVDE 547
           K ++V+DLD TL++S+ F  +++      F      D +       + ++    RP V E
Sbjct: 106 KLILVVDLDHTLINSTRFAHLSDDEKANGFTERTGDDRSRGLFRMGLFRMITKLRPFVHE 165

Query: 548 FLRRCGELY*CVLFTASLAKYADPVADLLDRWGVF 652
           FLR    ++   ++T     YA  VA LLD  G +
Sbjct: 166 FLREASAMFEMHVYTLGNRNYATAVAKLLDPDGAY 200


>06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797
          Length = 216

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 13/34 (38%), Positives = 15/34 (44%)
 Frame = -3

Query: 236 PPVPLDFFPPKGVDPETGVPSPSLCCTPGDEPLS 135
           PP P   +PP    P    P P    +PGD P S
Sbjct: 51  PPPPYCVYPPPPTKPALPAPLPPTPASPGDSPPS 84


>05_05_0152 +
           22762994-22763326,22763857-22763989,22764281-22764362,
           22764786-22764939,22765028-22765162
          Length = 278

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = +2

Query: 590 TASLAKYADPVADLLDRWGVFRARLFRDSCV-FHRGNYVKDLNSL 721
           +A  A+YA P+ D +D    F  RL+R S V      +VKDL+ L
Sbjct: 151 SAEKARYAKPLVDRIDAHNRFCHRLYRPSTVTTEYREHVKDLSCL 195


>05_04_0179 +
           18784011-18784240,18785035-18785119,18785905-18786102,
           18786347-18786527,18787026-18787315,18787583-18787771,
           18788316-18788792
          Length = 549

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 27/96 (28%), Positives = 44/96 (45%), Gaps = 13/96 (13%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSS----FKPINN-------AHFVVPVEIDGAVHQVYVLK--RPHVD 544
           K V+++DLD TL++S+         N       A  VVP      +  + +L   RP V 
Sbjct: 196 KLVLILDLDHTLINSTKLFDLSAAENELGIQSAAKEVVPDRSLFTLETMQMLTKLRPFVR 255

Query: 545 EFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVF 652
            FL+   +++   ++T     YA  +A LLD   V+
Sbjct: 256 RFLKEASDMFEMYIYTMGDKAYAIEIAKLLDPDNVY 291


>02_05_0312 - 27792127-27792360,27793282-27793412,27793534-27793837
          Length = 222

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 18/30 (60%), Positives = 20/30 (66%), Gaps = 2/30 (6%)
 Frame = -2

Query: 303 AIASGRSLAS--ATAPTAQQRSQEAAGPAR 220
           A AS   LAS  ATAPTA+ RS  +A PAR
Sbjct: 2   ATASSLFLASPVATAPTARARSTPSASPAR 31


>11_07_0002 - 27171791-27172222
          Length = 143

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = +1

Query: 139 RGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           RGS  G   + G G   SGSTP+GG +S   GG
Sbjct: 74  RGSPAGAGGSPGGG---SGSTPVGGGRSFAGGG 103


>10_06_0132 +
           11073057-11073345,11073899-11073903,11074358-11074404,
           11074843-11074967,11078036-11078592
          Length = 340

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 21/79 (26%), Positives = 34/79 (43%)
 Frame = -2

Query: 456 LNELCTNVSSKSITMTLFMHVLVSHWR*QRSGGMFRHDQQGRRSPAVDTIGAIASGRSLA 277
           +NE+CT + S  +T      V       +R G + +  ++  R P   T+G   +G S  
Sbjct: 142 INEMCTRIQSYRVTRKEETQVA----NVERGGDLLK--RRAPRKPKATTVGTSLAGAS-- 193

Query: 276 SATAPTAQQRSQEAAGPAR 220
           S+T P  Q+      G  R
Sbjct: 194 SSTQPEVQEEIPTMGGECR 212


>09_02_0279 + 6702517-6702948
          Length = 143

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = +1

Query: 139 RGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           RGS  G   + G G   SGSTP+GG +S   GG
Sbjct: 74  RGSPAGAGGSPGGG---SGSTPVGGGRSFAGGG 103


>02_01_0302 - 2021221-2023305
          Length = 694

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 16/28 (57%), Positives = 16/28 (57%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTPLGGK 216
           P  GSS G  H  G G P S STP GGK
Sbjct: 647 PSHGSSTGGGH--GGGHPPSTSTPPGGK 672


>11_06_0118 + 20308921-20309204,20310559-20310700
          Length = 141

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 22/83 (26%), Positives = 33/83 (39%), Gaps = 1/83 (1%)
 Frame = -3

Query: 359 ACSDMTSKGGEALPSILLVXXXXXXXXXXXXRQQHSNDR-KKPPVPLDFFPPKGVDPETG 183
           AC+  T+  G A P +                 + S D    PP PL   PP+G  P + 
Sbjct: 5   ACAASTTSVGPAHPRVSADSRGPARLRRLRVIPRASADSVAAPPAPL---PPRGQAPRSP 61

Query: 182 VPSPSLCCTPGDEPLSGP*LFNC 114
           +   ++  +   E +SGP  F C
Sbjct: 62  LLRVAIPASTAAEAVSGPVWFGC 84


>04_04_0640 -
           26891552-26891725,26891814-26892326,26892698-26893644,
           26893778-26894114,26894413-26894462,26895020-26895248
          Length = 749

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 1/35 (2%)
 Frame = -3

Query: 233 PVPLDFFPPKGVDPETGVPSPSLCCTPG-DEPLSG 132
           P PLD  P KG DPE   P   L   P  DEP SG
Sbjct: 330 PSPLDLPPMKGTDPED--PELILERKPSDDEPFSG 362


>03_06_0744 +
           35910512-35910569,35911145-35911325,35912332-35912419,
           35912541-35912726,35913591-35913725,35913803-35913862,
           35914609-35914698,35915384-35915515,35916039-35916183,
           35916266-35916439,35916629-35916692,35916778-35916847,
           35917328-35917445,35918258-35918280,35918398-35918499,
           35919831-35920250,35920327-35920563
          Length = 760

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 15/47 (31%), Positives = 19/47 (40%)
 Frame = +1

Query: 106 DDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGGFLR 246
           D  Q+ ++G D     G       G P     P GGK+   TG F R
Sbjct: 34  DLAQMFSHGADSAHDAGAVSTGASGVPTRFVWPYGGKRVYLTGSFTR 80


>09_06_0328 +
           22365308-22365415,22365743-22366018,22366166-22366417,
           22366542-22366939,22367028-22368021,22368199-22368409,
           22368515-22368749,22368874-22368996,22369190-22369310,
           22369416-22369625
          Length = 975

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +3

Query: 504 RSIKFTF*RGRMSTSSCGGAASFTSAFCSPRHWLSTPILSPIYWT 638
           +S+  TF R R++ S CG   + T  F  PRH  S P+L    W+
Sbjct: 211 KSLGSTFFR-RLAWSPCGHFITTTHGFQKPRH--SAPVLERGEWS 252


>08_02_0113 - 12715888-12716181,12717443-12717602,12718327-12718368,
            12718443-12718465,12718616-12720653,12720736-12720965,
            12722207-12722329,12722438-12723010,12724684-12724733,
            12726828-12726923,12726987-12727394,12727609-12727795
          Length = 1407

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 13/33 (39%), Positives = 16/33 (48%)
 Frame = +2

Query: 278  ARDLPEAMAPIVSTAGLLRPCWSCLNMPPDLCY 376
            A  LP   A   +   LLR CW CL+   + CY
Sbjct: 1221 AEQLPAQSAWSGNYLDLLRICWECLSWKHNKCY 1253


>03_05_0168 -
           21466431-21466445,21467053-21467160,21467222-21467365,
           21467778-21467846,21467928-21468071,21468409-21468565,
           21468671-21468767,21469015-21469297,21469382-21469507,
           21470098-21470178,21471990-21472072,21472393-21472478,
           21473329-21473422,21473516-21473681,21473777-21473851,
           21474082-21474157,21474259-21474347
          Length = 630

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = -3

Query: 257 HSNDRKKPPVPLDFFPP 207
           H+N  +KPP+ +DF PP
Sbjct: 401 HANGVEKPPIEIDFTPP 417


>01_06_1731 +
           39516897-39517632,39517744-39517912,39517985-39518488,
           39518619-39518747,39519849-39519990,39520082-39520453
          Length = 683

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 16/64 (25%), Positives = 30/64 (46%)
 Frame = -2

Query: 369 RSGGMFRHDQQGRRSPAVDTIGAIASGRSLASATAPTAQQRSQEAAGPARFLPTQRGRPR 190
           + GG   H+++ +   +     + A+  S ++ATAP+ Q +     G  R   + RG+  
Sbjct: 363 KGGGNAGHERKSKGGKSAAAACSTAASASSSTATAPSKQSQKGGGGGGGRG-GSWRGQKS 421

Query: 189 NWGA 178
            W A
Sbjct: 422 GWEA 425


>01_03_0068 - 12188426-12188767
          Length = 113

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = +1

Query: 133 PDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGGFLR 246
           P RGS   ++   G G+P  GS+  GG+ S G  G  R
Sbjct: 16  PPRGSGDRLELEAGGGSPPYGSS--GGRHSGGRRGLWR 51


>01_01_0570 - 4231100-4232560
          Length = 486

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +1

Query: 130 GPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGGF 240
           G   G++ G+    G G  + GS  LGG    G+GGF
Sbjct: 78  GTGGGAAGGLGGGGGGGGGLGGSGGLGGGGMGGSGGF 114


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,145,099
Number of Sequences: 37544
Number of extensions: 489298
Number of successful extensions: 1705
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 1610
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1698
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1874582652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).