SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0013
         (823 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_01_0160 + 2351438-2351761                                           33   0.21 
04_04_0411 - 25014511-25015015,25015098-25015169,25015700-250157...    32   0.63 
02_05_0190 - 26592452-26592693,26592911-26593004,26593425-265936...    32   0.63 
10_08_0106 + 14842748-14843085,14843122-14843250,14844145-148442...    31   1.1  
10_01_0073 - 955746-955758,955811-956832                               31   1.1  
10_01_0072 - 918323-918335,918388-919409                               31   1.1  
05_05_0294 + 23900690-23900812,23900976-23901008                       31   1.1  
06_01_0592 - 4277789-4278955                                           31   1.5  
07_01_0664 + 4979892-4979931,4980040-4980236,4982340-4982723,498...    30   1.9  
03_05_0161 + 21400580-21401695                                         30   2.6  
01_06_0575 - 30357556-30357582,30357698-30357944,30358039-303581...    29   3.4  
11_06_0717 - 26575009-26575152,26576461-26577978                       29   5.9  
09_02_0536 + 10354538-10354693,10357407-10357684,10357717-10357852     29   5.9  
06_01_1032 + 8055678-8055782,8055875-8055936,8057302-8057507,805...    29   5.9  
04_04_1202 - 31700414-31700854                                         29   5.9  
04_01_0611 - 8029101-8029205,8029985-8030107,8030191-8030556,803...    29   5.9  
11_06_0183 - 20999343-20999865,21000351-21000748                       28   7.8  
04_04_1652 - 35066814-35067659                                         28   7.8  
02_04_0312 - 21942310-21943356                                         28   7.8  

>09_01_0160 + 2351438-2351761
          Length = 107

 Score = 33.5 bits (73), Expect = 0.21
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = -1

Query: 598 SGFYQDAVHER*PVRSPPPLQYLAWEARLTP 506
           +G   D V    PVR+PP  Q+ AW ARL P
Sbjct: 29  AGVPADVVEAESPVRAPPDEQFAAWVARLRP 59


>04_04_0411 -
           25014511-25015015,25015098-25015169,25015700-25015734,
           25015805-25015873,25015993-25016044,25016444-25016526,
           25016625-25016726,25017150-25017884,25017962-25018012,
           25018792-25018983,25019066-25019216,25020012-25020193,
           25020329-25020532,25020752-25020859
          Length = 846

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 8/97 (8%)
 Frame = +1

Query: 379 IRDSGGVMAARVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAPPRPDIEEEEGFV 558
           + DSGG    R++ +    S  S      GES+K+  + + ++  D PP  D +E+    
Sbjct: 484 VSDSGGRATRRLAKDDDIKS--SFKKTGEGESSKKKQKENLKQQEDTPPDEDTDEDLSLK 541

Query: 559 PVIS--HGRRPGKNRRD------RERKAPPRAHKTPQ 645
            ++S     + GKN+         +RK    A +TPQ
Sbjct: 542 DIVSPKSSAKTGKNKGQAGDSGGSKRKRAQEAEETPQ 578


>02_05_0190 -
           26592452-26592693,26592911-26593004,26593425-26593656,
           26594660-26595066
          Length = 324

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 26/74 (35%), Positives = 34/74 (45%), Gaps = 4/74 (5%)
 Frame = +1

Query: 346 ASRRGARARTYIRDSGGVMAARV----SAEGAGPSYASVLNFKGGESNKENIEAHAEEAL 513
           +S  G R RT  R  G ++ A      SA  A   + S    + GE   E + A AEEA+
Sbjct: 43  SSSSGGRPRT--RSGGRLLRATSPPPPSAIAAAACWESRTMRREGEEEWEEVVAGAEEAV 100

Query: 514 DAPPRPDIEEEEGF 555
              P P  EEEE +
Sbjct: 101 HGAPVPVAEEEEEY 114


>10_08_0106 + 14842748-14843085,14843122-14843250,14844145-14844211,
            14847177-14847324,14847998-14848097,14848306-14848384,
            14848527-14848687,14848829-14848908,14849319-14849475,
            14849575-14849723,14849909-14850076,14850426-14850719,
            14851002-14851046,14851213-14851462,14851707-14851835,
            14852799-14853039,14853977-14854642
          Length = 1066

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 22/97 (22%), Positives = 40/97 (41%)
 Frame = +1

Query: 346  ASRRGARARTYIRDSGGVMAARVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAPP 525
            ASR  A    + +++     AR  A+G   S  S ++F GG+ N  + +     + D PP
Sbjct: 900  ASRHEAAEHAHAKNTAAAADARSKAKG---SVFSRISFPGGDGNPSDAKRSRRSSSDKPP 956

Query: 526  RPDIEEEEGFVPVISHGRRPGKNRRDRERKAPPRAHK 636
                   +     ++     G++ R   R+A   A +
Sbjct: 957  ASSSSSSKKARAAVAED-NDGRHHRRHHREAAAAAEE 992


>10_01_0073 - 955746-955758,955811-956832
          Length = 344

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +1

Query: 511 LDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERKAPPRA 630
           +D PP P  + ++G  P +   ++P K+   RE  APP A
Sbjct: 184 IDEPPPPK-KRQQGRQPKVPRAKKPKKSAAPREDGAPPNA 222


>10_01_0072 - 918323-918335,918388-919409
          Length = 344

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +1

Query: 511 LDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERKAPPRA 630
           +D PP P  + ++G  P +   ++P K+   RE  APP A
Sbjct: 184 IDEPPPPK-KRQQGRQPKVPRAKKPKKSAAPREDGAPPNA 222


>05_05_0294 + 23900690-23900812,23900976-23901008
          Length = 51

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)
 Frame = +2

Query: 563 SSLMDGVLVKTGGTGNGKHPR-ELIKHHNSMLTLSP 667
           ++L+DGV V  GG  NG+ P  E+IKHH+ +    P
Sbjct: 17  AALVDGVAVD-GGEANGEVPADEVIKHHHKLYEQQP 51


>06_01_0592 - 4277789-4278955
          Length = 388

 Score = 30.7 bits (66), Expect = 1.5
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = -1

Query: 562 PVRSPPPLQYLAWEARLTP 506
           PVR+PP  Q+ AW ARL P
Sbjct: 44  PVRAPPDEQFAAWVARLRP 62


>07_01_0664 +
           4979892-4979931,4980040-4980236,4982340-4982723,
           4983499-4983549,4983659-4983741,4983818-4983917,
           4984410-4984488,4984957-4985080,4985605-4985711,
           4985810-4985938,4987004-4987089,4987200-4987367,
           4987477-4987637,4987721-4987752,4987866-4988047,
           4988386-4988465,4988885-4988950,4989060-4989349,
           4990433-4990540,4991521-4991618,4991680-4991782,
           4992269-4992345,4992449-4992520,4992579-4992670,
           4992909-4992989,4993290-4993392,4994334-4994492,
           4994696-4995085
          Length = 1213

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = -1

Query: 607 PCPS-GFYQDAVHER*PVRSPPPLQYLAWEARLTPPLRGP 491
           P PS G+Y    ++  PV +PP  QY    A+  PP R P
Sbjct: 9   PYPSQGYYNQGPYQGPPVMAPPHAQYQYQYAQPPPPPRQP 48


>03_05_0161 + 21400580-21401695
          Length = 371

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +3

Query: 756 GGSTGVPPPAPPALEQEKRSPL 821
           GG T  PPP PPA +Q+++ PL
Sbjct: 18  GGGTTTPPPPPPA-QQQQQQPL 38


>01_06_0575 -
           30357556-30357582,30357698-30357944,30358039-30358161,
           30358275-30358301,30358475-30358633,30359764-30359948,
           30360225-30360293,30360432-30362354,30363018-30363339,
           30363506-30363543
          Length = 1039

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 1/32 (3%)
 Frame = +3

Query: 723 AYSKSNPWQV-RGGSTGVPPPAPPALEQEKRS 815
           A   S  W   RGG  G PPP  P +E  KRS
Sbjct: 21  AVDASKCWPFGRGGGDGEPPPPLPPMEPPKRS 52


>11_06_0717 - 26575009-26575152,26576461-26577978
          Length = 553

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%)
 Frame = +1

Query: 388 SGGVMAARVSAEGAGPSYASVLNFK-GGESNKENIEAHAEEALDAPPRPDIEEEEGFVPV 564
           +G      ++ +G   + A V   K GG++       HA   LD+ P  D +   GF+ +
Sbjct: 45  AGATRLMEMTTKGRADANAKVNQLKAGGDTKFLPALKHASGLLDSRPAGDKQYRPGFIFL 104

Query: 565 ISHGRRPG 588
           +S G+  G
Sbjct: 105 LSDGQDNG 112


>09_02_0536 + 10354538-10354693,10357407-10357684,10357717-10357852
          Length = 189

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = -1

Query: 619 VLSVPCPSGFYQDAVHER*PVRSPPPLQYLAW 524
           +L +  PS FY   +H      +PPP+Q+ AW
Sbjct: 30  ILELHIPSNFYYPQLHR---TGAPPPVQHRAW 58


>06_01_1032 + 8055678-8055782,8055875-8055936,8057302-8057507,
            8057595-8058314,8058404-8058603,8058988-8059172,
            8059287-8059354,8059432-8060246,8060502-8060599,
            8060702-8060887,8061358-8061538,8061651-8061812,
            8061894-8061937,8062059-8062115,8062409-8062505,
            8062614-8062786,8062868-8063081,8063270-8063395,
            8064072-8064188,8064459-8064566,8064729-8064898,
            8065049-8065127,8065211-8065285,8065845-8065942,
            8066030-8066137,8066238-8066295,8066527-8066631,
            8067461-8069516,8069804-8070697,8070896-8071852,
            8072022-8072075,8072157-8072222,8072294-8073472,
            8073868-8075598,8075764-8075829,8076763-8077788,
            8077893-8078041
          Length = 4264

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 16/54 (29%), Positives = 28/54 (51%)
 Frame = +1

Query: 352  RRGARARTYIRDSGGVMAARVSAEGAGPSYASVLNFKGGESNKENIEAHAEEAL 513
            RRG + ++    +G V+ + V A G+G +YAS +     + N  +  A+A   L
Sbjct: 1748 RRGRKPKSLAASAGDVILSPVVAVGSGEAYASSVVSSYPQGNVSSSHANAMAGL 1801


>04_04_1202 - 31700414-31700854
          Length = 146

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +1

Query: 400 MAARVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAPPRPDI 537
           + AR S E A P  +S++  +        ++  AEE  DAPP P I
Sbjct: 6   LVARFSVEVAPPLLSSIIRPRRRRGFPAMLDTIAEEEPDAPPLPAI 51


>04_01_0611 -
           8029101-8029205,8029985-8030107,8030191-8030556,
           8030639-8031124
          Length = 359

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 17/73 (23%)
 Frame = +1

Query: 379 IRDSGGVMAARVSAEGAGPSY-----------ASVLNFKGGESNKE-NIEAHAEEAL--- 513
           +R+ G   A RV A+GA PSY           A+  + +GG + K   +E   EE     
Sbjct: 34  VREEGHSYAVRVPADGANPSYYLQYEKPLTNGAASTSSRGGAARKRCRMEEEEEEESSSG 93

Query: 514 --DAPPRPDIEEE 546
             +  P PDIEE+
Sbjct: 94  EPEPAPDPDIEED 106


>11_06_0183 - 20999343-20999865,21000351-21000748
          Length = 306

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
 Frame = +3

Query: 663 AHSGATATSCRTTAEEVC*SAYSKSN--PWQVRGGSTGVPPPAP 788
           + S   ATS  T+ E++  S+  KS+  PW    G  G  PPAP
Sbjct: 21  SRSVVVATSSITSLEQLAASSSVKSSGAPWLGGSGILGPQPPAP 64


>04_04_1652 - 35066814-35067659
          Length = 281

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 6/74 (8%)
 Frame = +1

Query: 340 VIAS-RRGARARTYIRDSGGVMAARVSAEGAGPSYASVL-----NFKGGESNKENIEAHA 501
           ++AS  R  RAR    + G  +AA V+ EG+G    + L       +GG S +E   A A
Sbjct: 56  ILASLARPRRARRVPLEEGTDLAAAVAREGSGCYVLAALRRSRRERRGGRSRREKKAAAA 115

Query: 502 EEALDAPPRPDIEE 543
             A  A P    +E
Sbjct: 116 AAAAGAAPAAPTQE 129


>02_04_0312 - 21942310-21943356
          Length = 348

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = +3

Query: 774 PPPAPPALEQEKRSP 818
           PPP PP+LEQ+  SP
Sbjct: 181 PPPPPPSLEQDTASP 195


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,782,221
Number of Sequences: 37544
Number of extensions: 520605
Number of successful extensions: 2795
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 2492
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2772
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2256438528
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).