SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0011
         (939 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_0235 + 23819060-23819114,23819486-23819542,23819707-238198...    32   0.76 
04_04_0362 + 24716342-24716426,24716591-24717088,24717210-24717748     30   2.3  
12_01_0647 - 5485100-5487028                                           29   4.0  
08_01_0256 + 2102044-2102883,2104208-2104741,2104838-2104945           29   4.0  
04_01_0052 - 548383-548494,548523-548592,549184-549364                 29   4.0  
07_03_1575 - 27848977-27849095,27849254-27849302,27850270-278502...    29   5.3  
03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105           29   5.3  
02_01_0451 - 3237849-3238061,3238142-3238268,3238418-3238656,323...    29   5.3  
01_02_0060 - 10711215-10711801,10711840-10712026,10712117-10712347     29   5.3  
11_03_0055 - 9356602-9356709,9357042-9357221                           29   7.1  
10_08_0258 + 16261454-16261540,16261636-16261712,16262734-162628...    29   7.1  
08_01_0982 - 9947192-9947474,9948649-9948950                           29   7.1  
01_05_0581 + 23404809-23405885,23406434-23406580,23406688-23407056     29   7.1  
02_03_0248 - 16820997-16821275,16821979-16822147,16822350-16822678     28   9.3  

>04_04_0235 +
           23819060-23819114,23819486-23819542,23819707-23819808,
           23820162-23820238,23820347-23820470,23820730-23820794,
           23821827-23821896,23822395-23822470,23822597-23822687,
           23822767-23822889
          Length = 279

 Score = 31.9 bits (69), Expect = 0.76
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +1

Query: 271 VSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTEPAPYRPS 402
           ++DEP +     KL  D KE   AN TS+A       P P+ P+
Sbjct: 195 LNDEPWLTLLCKKLQLDIKEIIEANKTSEASFCAENSPVPFHPA 238


>04_04_0362 + 24716342-24716426,24716591-24717088,24717210-24717748
          Length = 373

 Score = 30.3 bits (65), Expect = 2.3
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +1

Query: 529 TVMCEITFDPG-KFDTLCGPLVDSFA-STLNDESYTR 633
           +V+  I  +PG   D  CGPL+DSFA  TLN    T+
Sbjct: 158 SVVLFIVHNPGVSDDEACGPLIDSFAIKTLNPPQRTK 194


>12_01_0647 - 5485100-5487028
          Length = 642

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 2/45 (4%)
 Frame = +2

Query: 719 QWRNLRSLYSASACSSAVPLRKTRLSAAWKLQRRI--CVDLLCSL 847
           QW  L S++SAS   S + L  TRL++   L RRI  C + + SL
Sbjct: 314 QWERLLSVFSASKTGSKI-LLTTRLNSVATLARRITGCEERVMSL 357


>08_01_0256 + 2102044-2102883,2104208-2104741,2104838-2104945
          Length = 493

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
 Frame = +2

Query: 350 LLKPYPLTTL-NLPHIDHLAPLY 415
           LL+ +PLT L +L H+DH+ PLY
Sbjct: 290 LLRAHPLTPLVSLHHLDHVYPLY 312


>04_01_0052 - 548383-548494,548523-548592,549184-549364
          Length = 120

 Score = 29.5 bits (63), Expect = 4.0
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 4/43 (9%)
 Frame = +1

Query: 550 FDPGKFDTLCG----PLVDSFASTLNDESYTRPLVDAIVNQSI 666
           FD G FDT+C     P +DSFA+   D SY   ++DA+V+ ++
Sbjct: 33  FDSGMFDTVCSIGQFPALDSFAAQEFD-SY--DVIDAVVSGAV 72


>07_03_1575 -
           27848977-27849095,27849254-27849302,27850270-27850287,
           27850798-27851786,27852119-27852733,27852893-27852921,
           27853990-27854453,27854530-27854654,27854743-27855025,
           27855112-27856102,27856965-27857576,27857666-27858630
          Length = 1752

 Score = 29.1 bits (62), Expect = 5.3
 Identities = 19/53 (35%), Positives = 27/53 (50%)
 Frame = +1

Query: 775 VEENKIISGLETSEENMRGFAMFLAEIILSFEDSQGGRIRLSVKSLQVFCIYW 933
           V + K + GL+ SE+NM    +    IILS E+   G +    K+ Q F  YW
Sbjct: 787 VTDGKCMEGLQ-SEKNMNSHIILAIHIILSIEERLNGLLIGPWKNPQ-FSSYW 837


>03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105
          Length = 430

 Score = 29.1 bits (62), Expect = 5.3
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 1/64 (1%)
 Frame = +1

Query: 259 RPKAVSDEPKVDTSKSK-LSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQA 435
           +P +    P  ++S S  + A A  + P  YT+  LP Y  +   Y P  PS+Q  L   
Sbjct: 36  QPSSPPPPPPPESSPSHYVFAAATPYPPPQYTNPNLPRYYPQYGNYYPPPPSLQVPLPAP 95

Query: 436 QDQN 447
            D +
Sbjct: 96  YDHH 99


>02_01_0451 -
           3237849-3238061,3238142-3238268,3238418-3238656,
           3238937-3239151,3239569-3240031,3240562-3240715,
           3241724-3241833,3242540-3242797,3242843-3242854,
           3243492-3243545,3244202-3244312,3244390-3244545,
           3244798-3245201,3245405-3245501,3246041-3246050,
           3246097-3246164,3246652-3246762,3246874-3247074,
           3247384-3247485,3247980-3248087,3248209-3248411,
           3248563-3248680,3248774-3248854,3248958-3249500,
           3249602-3249730
          Length = 1428

 Score = 29.1 bits (62), Expect = 5.3
 Identities = 21/104 (20%), Positives = 38/104 (36%), Gaps = 2/104 (1%)
 Frame = +1

Query: 205 PKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTEP 384
           P G  +G  + N        K   D  +VD   +  S D  + Y   +      A+  + 
Sbjct: 211 PPGFRKGLDLGNLKEYKSHWKCYQDGERVDEQSTSSSNDTMDKYSVQFDDLFKIAWEEDS 270

Query: 385 APYRPSRPSVQGRL--RQAQDQNPYNLDDMSYSLEEAENMDLRE 510
               P    VQ  +   +  D +  N+  +  + E  EN+D+ +
Sbjct: 271 DDKVPREDHVQQLVGDEETNDVDKQNISKLQNASETIENLDIEK 314


>01_02_0060 - 10711215-10711801,10711840-10712026,10712117-10712347
          Length = 334

 Score = 29.1 bits (62), Expect = 5.3
 Identities = 28/111 (25%), Positives = 40/111 (36%), Gaps = 1/111 (0%)
 Frame = +1

Query: 313 SADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAE 492
           +ADA    P + T  A    N     + P    +          +  N DD   + +   
Sbjct: 150 AADATNTLPDSKTGVATLISNFAKKGFTPEELVILSGAHSIGKAHSSNFDDRLTAPDSEI 209

Query: 493 NMDLRENIANLITVMCEITFDPGKFDTLCGPLVDSFASTLND-ESYTRPLV 642
           N D R+N+ N          +P    TL   + D  A+TL D  SY  P V
Sbjct: 210 NADYRDNVLNKTCKSSSAAANP----TLANNIRDIDAATLGDLASYVVPAV 256


>11_03_0055 - 9356602-9356709,9357042-9357221
          Length = 95

 Score = 28.7 bits (61), Expect = 7.1
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 4/25 (16%)
 Frame = -3

Query: 604 KQMNPPRDHTRCQ-TCP---GQRLS 542
           K+ N PRDH++C+  CP   GQRLS
Sbjct: 55  KKKNEPRDHSQCKPECPWSFGQRLS 79


>10_08_0258 +
           16261454-16261540,16261636-16261712,16262734-16262818,
           16262931-16263057,16263147-16263245,16263343-16263410,
           16263514-16263621,16263727-16263804,16263921-16264053,
           16264138-16264234,16264465-16264588,16264668-16264776,
           16264899-16264982,16265071-16265180
          Length = 461

 Score = 28.7 bits (61), Expect = 7.1
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = -3

Query: 439 LELDEVYLVQRGEMVYMGQVQCCKRVGLE--KCNLQG 335
           L++D+V L +  E      V CCK++GL+  K N+ G
Sbjct: 349 LQIDDVDLFEINEAFASQYVYCCKKLGLDPAKVNVNG 385


>08_01_0982 - 9947192-9947474,9948649-9948950
          Length = 194

 Score = 28.7 bits (61), Expect = 7.1
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +1

Query: 187 NGDISAPKGRGRGWQMNNQARELR 258
           NGD+ AP G G+G    N  RE R
Sbjct: 134 NGDLRAPSGGGQGLGSRNTCREAR 157


>01_05_0581 + 23404809-23405885,23406434-23406580,23406688-23407056
          Length = 530

 Score = 28.7 bits (61), Expect = 7.1
 Identities = 20/67 (29%), Positives = 32/67 (47%)
 Frame = +1

Query: 715 DSVAQPEESVFRECLLERCSVEENKIISGLETSEENMRGFAMFLAEIILSFEDSQGGRIR 894
           D  A P     RE +L R ++EE  +        EN+   +  L  ++L+F     GR+R
Sbjct: 232 DGAAPPSFPRLRELVLNRSAIEEADL--------ENVVACSPALRTLVLAFSRGAPGRVR 283

Query: 895 LSVKSLQ 915
           L+  SL+
Sbjct: 284 LASGSLR 290


>02_03_0248 - 16820997-16821275,16821979-16822147,16822350-16822678
          Length = 258

 Score = 28.3 bits (60), Expect = 9.3
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = -3

Query: 490 QLLQVNKTCHPNCMDFDLELDEVYLVQRG 404
           ++L V  +C P CM+   +LD++ LV RG
Sbjct: 57  RVLMVLMSCCPICMNLYFDLDDIELVFRG 85


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,589,385
Number of Sequences: 37544
Number of extensions: 604526
Number of successful extensions: 1803
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 1725
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1803
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2694390200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).