SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0009
         (585 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_08_0233 - 16061182-16061714,16062765-16063578                       33   0.13 
08_02_0037 + 11480213-11481013,11483612-11483707                       33   0.13 
10_01_0098 - 1193184-1193703,1193814-1193872                           32   0.39 
03_06_0471 + 34169562-34169892,34170121-34170347                       31   0.89 
10_01_0324 + 3566638-3566859,3566959-3567223,3567881-3568161           30   1.2  
12_02_0674 - 21745321-21746223,21746229-21747608                       29   2.1  
12_02_0364 - 18020249-18020737,18021075-18021502,18021563-180216...    29   2.1  
12_01_0656 - 5554906-5555194,5555640-5556178                           29   2.7  
08_01_0758 - 7193287-7193871,7193965-7194421,7194437-7194655,719...    29   2.7  
08_01_0757 - 7164380-7164490,7164585-7165041,7165057-7165275,716...    29   2.7  
05_03_0356 + 12894195-12894237,12894347-12894484,12894868-128950...    29   2.7  
01_06_1440 + 37378121-37378958,37379344-37379494,37379567-373799...    29   2.7  
01_06_0718 - 31467530-31467892,31468017-31468178,31468268-314684...    29   3.6  
12_02_0064 + 13104835-13105311,13107731-13108119,13108156-131082...    28   4.8  
11_03_0146 + 10744403-10744603,10745199-10745834,10745967-107461...    28   4.8  
08_01_0876 - 8598664-8599374                                           28   4.8  
07_03_0991 + 23174743-23175726                                         28   4.8  
05_04_0010 - 17132810-17132935,17133017-17133169,17133202-171332...    28   4.8  
01_03_0138 + 12963464-12965059,12965085-12965660                       28   4.8  
11_01_0283 - 2095291-2095566,2095962-2096348,2096523-2096881,209...    28   6.3  
08_02_0360 + 16196712-16197560,16198126-16198875                       28   6.3  
01_04_0138 + 16554175-16554822                                         28   6.3  
12_01_0900 - 8724339-8724380,8725263-8725376,8726491-8726559,872...    27   8.3  
09_06_0010 - 20193577-20193921,20194014-20194160,20194239-201944...    27   8.3  
08_02_1335 - 26226784-26227015,26227493-26228474,26229021-26230686     27   8.3  
01_06_1535 + 38057802-38057999,38058338-38058437,38058730-380588...    27   8.3  
01_01_0722 + 5639760-5640101                                           27   8.3  

>10_08_0233 - 16061182-16061714,16062765-16063578
          Length = 448

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 18/46 (39%), Positives = 22/46 (47%)
 Frame = -1

Query: 198 PTTE*SPLSASSNSRLPTAEFSREPHATCFALRSPTSRAGRLSQFR 61
           PT   +PL +SS+S LP       P +   A R PTS AG     R
Sbjct: 120 PTVNGAPLCSSSSSALPPPHSRTPPASPLAAARGPTSHAGETGSRR 165


>08_02_0037 + 11480213-11481013,11483612-11483707
          Length = 298

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 21/59 (35%), Positives = 28/59 (47%)
 Frame = +3

Query: 369 RPRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTRRRLLCPAAG 545
           RPRP +R    + L  A          TPL  + T  S  S+ SG+ S+R+R   P AG
Sbjct: 173 RPRPVERAHVKTVLAAAKEAMEASSPETPLDYAATTGSGASS-SGDESSRKRKAAPGAG 230


>10_01_0098 - 1193184-1193703,1193814-1193872
          Length = 192

 Score = 31.9 bits (69), Expect = 0.39
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +2

Query: 377 PLRPKVDWELFKRRLVDLPA 436
           PL+P VD EL+KRR++DL A
Sbjct: 142 PLQPHVDQELYKRRMMDLDA 161


>03_06_0471 + 34169562-34169892,34170121-34170347
          Length = 185

 Score = 30.7 bits (66), Expect = 0.89
 Identities = 15/28 (53%), Positives = 18/28 (64%)
 Frame = +1

Query: 271 GATVPLNY*GTVRPGYPPSPYPGHTGNG 354
           GA  P  Y    +PGYPP+ YPGH G+G
Sbjct: 82  GAYPPSGY--PQQPGYPPAGYPGH-GHG 106


>10_01_0324 + 3566638-3566859,3566959-3567223,3567881-3568161
          Length = 255

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -2

Query: 206 RRGRPQ-SSRPYRHLLTAACPLLSSVGSPTRRASR*GP 96
           +RGRP+ SSR         C + ++V  PTRR++R GP
Sbjct: 178 KRGRPRGSSRGRGRGTNVGCKVSTAVPRPTRRSTREGP 215


>12_02_0674 - 21745321-21746223,21746229-21747608
          Length = 760

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 29/78 (37%), Positives = 33/78 (42%), Gaps = 1/78 (1%)
 Frame = -1

Query: 393 TFGRRGEVATRVSPIPSVTRIGRWGVPRSYSASIVKGHRSPL*THTSNTSGWSCAAVGMC 214
           T  R GE++T    IP+ TR G      S       G  S L T TS  S  SCA     
Sbjct: 622 TTARTGELSTPTDKIPTTTRAGDLSTATS-KIPTAPG-TSELSTTTSKISSTSCAGQFST 679

Query: 213 VGSSGPTTE-*SPLSASS 163
                PTT   S L+ASS
Sbjct: 680 STYGIPTTTCTSKLTASS 697


>12_02_0364 -
           18020249-18020737,18021075-18021502,18021563-18021649,
           18022059-18022192,18023051-18023053,18023129-18023187,
           18023429-18023887
          Length = 552

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 14/29 (48%), Positives = 16/29 (55%)
 Frame = +1

Query: 37  SPRGHKTGPELRQPPSSAGRGPQREARRV 123
           +PRG  T      PP +AGRG    ARRV
Sbjct: 25  TPRGMSTPDGTATPPPAAGRGAATPARRV 53


>12_01_0656 - 5554906-5555194,5555640-5556178
          Length = 275

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = -1

Query: 171 ASSNSRLPTAEFSREPHATCFAL 103
           A+S +++PT ++S+E HA C  L
Sbjct: 106 ATSTTKIPTTDYSKETHAKCSML 128


>08_01_0758 -
           7193287-7193871,7193965-7194421,7194437-7194655,
           7194881-7195419
          Length = 599

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = -1

Query: 171 ASSNSRLPTAEFSREPHATCFAL 103
           A+S +++PT ++S+E HA C  L
Sbjct: 106 ATSTTKIPTTDYSKETHAKCSML 128


>08_01_0757 -
           7164380-7164490,7164585-7165041,7165057-7165275,
           7165501-7165757
          Length = 347

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = -1

Query: 171 ASSNSRLPTAEFSREPHATCFAL 103
           A+S +++PT ++S+E HA C  L
Sbjct: 12  ATSTTKIPTTDYSKETHAKCSML 34


>05_03_0356 +
           12894195-12894237,12894347-12894484,12894868-12895018,
           12895399-12895526,12895704-12895840,12896742-12896847,
           12898659-12898762,12899159-12899281,12899620-12899700,
           12900159-12900304,12902171-12902243,12902970-12903060,
           12904978-12905018,12906079-12906153,12906402-12906569,
           12907638-12907676,12907759-12907847,12908014-12908078,
           12908794-12908840,12908924-12908983,12909168-12909239,
           12910143-12910172,12910526-12910617,12910719-12910802,
           12911941-12912046,12912171-12912233,12912776-12912870,
           12913000-12913180
          Length = 875

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%)
 Frame = +1

Query: 37  SPRGHKTGPELRQPPSSAGRGPQ-REARR 120
           +PRGHK  P+ R  PS  G GP+ RE +R
Sbjct: 12  APRGHKRRPK-RTRPSGKGGGPEPREEKR 39


>01_06_1440 + 37378121-37378958,37379344-37379494,37379567-37379936,
            37380021-37380431,37380522-37380820,37380897-37381155,
            37381248-37381497,37381744-37381875,37381936-37382208,
            37383023-37383267
          Length = 1075

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 2/86 (2%)
 Frame = +3

Query: 315  VPPISLSWSHWEWGSPGLRPRPYDRRSTGSSLRDA*STFP-QFRTPT-PLRGSTTRQSAL 488
            VPP  L++SH    + G R R +   ST S LR A    P +F  P+ P+      Q  +
Sbjct: 974  VPPDRLTYSHGHIRAQGRRDREH---STKSPLRRAARGPPAKFHAPSPPICRRPPAQYKI 1030

Query: 489  STPSGERSTRRRLLCPAAGPEVYSRP 566
            +   G +    +  CP + P +  RP
Sbjct: 1031 TLAEGGKGAACKFPCPPS-PPICRRP 1055


>01_06_0718 -
           31467530-31467892,31468017-31468178,31468268-31468415,
           31468536-31468612,31468693-31468763,31468965-31469051,
           31469138-31469602,31470357-31470659,31471151-31471202
          Length = 575

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 19/67 (28%), Positives = 27/67 (40%)
 Frame = -1

Query: 258 TSNTSGWSCAAVGMCVGSSGPTTE*SPLSASSNSRLPTAEFSREPHATCFALRSPTSRAG 79
           T + S   C+  G+   S   TT  SP   +S+   PT + S     TC+     +S  G
Sbjct: 34  TRDASSGDCSPAGL-TPSGDATTGDSPAGVTSSGESPTCDTSPGEPPTCYTSPGDSSYTG 92

Query: 78  RLSQFRT 58
             S   T
Sbjct: 93  GSSTSAT 99


>12_02_0064 +
           13104835-13105311,13107731-13108119,13108156-13108286,
           13108378-13108469,13108488-13109264,13109291-13109320
          Length = 631

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = +1

Query: 304 VRPGYPPSPYPGHTGNG 354
           V PGY P+P PGH   G
Sbjct: 448 VTPGYTPTPSPGHNETG 464


>11_03_0146 + 10744403-10744603,10745199-10745834,10745967-10746125,
            10746398-10747036,10748018-10748151,10748281-10748464,
            10748882-10749217,10751659-10751945,10752863-10753253,
            10753351-10753615,10753740-10753818,10754123-10754543
          Length = 1243

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = -2

Query: 257  HPTRRAGVARRSECAWVRRGRPQSSRPYRHLLT-AACPLLSSVGSPTRRASR*GP 96
            +PT    V + +     +RGRP+ S   R   T A C + ++V   TRR++R GP
Sbjct: 1149 NPTNFNKVMKAANRGKGKRGRPRGSGRGRGRGTNAGCKVSTAVPRTTRRSTREGP 1203


>08_01_0876 - 8598664-8599374
          Length = 236

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 14/45 (31%), Positives = 18/45 (40%)
 Frame = -2

Query: 212 WVRRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPRPAELG 78
           W +     +S P R  +  A PLL      +RR  R G R    G
Sbjct: 144 WAKEAAASASGPRRWTMDGAAPLLPETSPKSRRGRRGGRRSPRRG 188


>07_03_0991 + 23174743-23175726
          Length = 327

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 17/55 (30%), Positives = 23/55 (41%)
 Frame = +2

Query: 149 GRRLLEDADRGDYSVVGPDEPTHIPTAAQLQPDVLDVCVHKGLRCPLTIEALYDL 313
           GRR+  D    DY +   DE +  P      P  L V  + G R   T+  L+ L
Sbjct: 73  GRRVTGDRTPADYDMEDGDEVSFFPDGTWTTPVTLTVTDNNGRRVTHTMRRLHIL 127


>05_04_0010 -
           17132810-17132935,17133017-17133169,17133202-17133263,
           17133384-17133435,17133794-17133883,17134075-17134170,
           17134258-17134311,17134575-17134665,17134996-17135072,
           17135770-17135852,17136057-17136111
          Length = 312

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 21/96 (21%), Positives = 41/96 (42%)
 Frame = +2

Query: 245 DVLDVCVHKGLRCPLTIEALYDLGTPHLPILVTLGMGLTRVATSPLRPKVDWELFKRRLV 424
           D +  C+++ LR    + A  +L  P   ++      +T   T+PL      ++ K RL+
Sbjct: 165 DAIQFCIYEQLRIGYKVVAKRELNDPENALIGAFAGAITGAITTPL------DVMKTRLM 218

Query: 425 DLPAIQDPNTPEGVDDAAVRLVDSIRGAIDQATTLV 532
                   +TP G+ D         +G+ +Q + +V
Sbjct: 219 VQNNTSFLSTPVGIADPIYFFGPQSQGSANQYSGIV 254


>01_03_0138 + 12963464-12965059,12965085-12965660
          Length = 723

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 17/57 (29%), Positives = 27/57 (47%)
 Frame = +2

Query: 185 YSVVGPDEPTHIPTAAQLQPDVLDVCVHKGLRCPLTIEALYDLGTPHLPILVTLGMG 355
           + +  PD  + + T  +L+   L   + K LR  L+   L D G+P+    V  GMG
Sbjct: 255 WQMAAPDSDSLLATRPELRDLCLSYSLFKSLRRRLSGYPLADAGSPNALDFVLRGMG 311


>11_01_0283 -
           2095291-2095566,2095962-2096348,2096523-2096881,
           2097275-2097398,2097480-2097548,2098536-2098584,
           2099185-2099299,2099823-2099872,2099969-2100106,
           2101136-2101197,2102066-2102180,2103433-2103664,
           2103748-2103826,2103925-2103993,2104079-2104171,
           2104577-2104622,2105223-2105268,2105354-2105411,
           2105577-2105615,2105712-2105783,2105930-2106021,
           2106824-2106923
          Length = 889

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 17/35 (48%), Positives = 19/35 (54%)
 Frame = -1

Query: 174 SASSNSRLPTAEFSREPHATCFALRSPTSRAGRLS 70
           +A S+S  P A  SR P   C ALR   S  GRLS
Sbjct: 311 TAHSSSPAPAAVTSRRP---CMALREAGSNPGRLS 342


>08_02_0360 + 16196712-16197560,16198126-16198875
          Length = 532

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/43 (37%), Positives = 20/43 (46%)
 Frame = +3

Query: 360 PGLRPRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSAL 488
           PG+RP P   RS   SL     T  + R  +P R  TT +  L
Sbjct: 309 PGVRPNPSRPRSVARSLSPRHVTRTKIRGDSPARRPTTGELGL 351


>01_04_0138 + 16554175-16554822
          Length = 215

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +3

Query: 450 TPLRGSTTRQSALSTPSGERSTRRRLLCPAAGPEV 554
           T  RGS  R++A+   +G+  TRR   C AA   V
Sbjct: 108 TMRRGSRRRKAAIGRRTGKSGTRRSRRCVAAAARV 142


>12_01_0900 -
           8724339-8724380,8725263-8725376,8726491-8726559,
           8726665-8726824,8726905-8726961,8728080-8728258,
           8728332-8728442,8728512-8728535,8729993-8730107,
           8730665-8730720,8731595-8731807
          Length = 379

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 17/51 (33%), Positives = 29/51 (56%)
 Frame = +2

Query: 353 GLTRVATSPLRPKVDWELFKRRLVDLPAIQDPNTPEGVDDAAVRLVDSIRG 505
           GL +  TSP++ +V W  +++ L     I+ P  P+   DAAV +  ++RG
Sbjct: 75  GLAQHVTSPMQAQVTW--YRKLLAAYKDIKYP--PKESADAAVLVAATLRG 121


>09_06_0010 -
           20193577-20193921,20194014-20194160,20194239-20194495,
           20194619-20194826
          Length = 318

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = +2

Query: 332 ILVTLGMGLTRVATSPLRPKVDWELF 409
           +  T+    T   TSP+ P+ DWELF
Sbjct: 294 VTTTMAAATTTTTTSPI-PRFDWELF 318


>08_02_1335 - 26226784-26227015,26227493-26228474,26229021-26230686
          Length = 959

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 15/55 (27%), Positives = 27/55 (49%)
 Frame = +2

Query: 158 LLEDADRGDYSVVGPDEPTHIPTAAQLQPDVLDVCVHKGLRCPLTIEALYDLGTP 322
           LL + D+ + S+V P  PT + +  ++Q      C H      ++ E +Y+L  P
Sbjct: 430 LLNELDKEEKSMVPPVSPTVVDSIFRVQLSATISCSHCSYN-SVSHEVMYELSVP 483


>01_06_1535 + 38057802-38057999,38058338-38058437,38058730-38058890,
            38059166-38059363,38059442-38059534,38059732-38059854,
            38060637-38060884,38061004-38061175,38061407-38061493,
            38061523-38061786,38062415-38062577,38062839-38062926,
            38063010-38063079,38063566-38063694,38063773-38063811,
            38065539-38065760,38065935-38065999,38066095-38066288,
            38066539-38066805,38066908-38066995,38067091-38067216,
            38067291-38067400,38067523-38067671
          Length = 1117

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -2

Query: 137  SVGSPTRRASR*GPRPAELGGCRNSGPVLCPRG 39
            ++G  T R ++   RP    GC  SGPVL  +G
Sbjct: 959  NLGMLTSRLAKYRTRPRVYVGCMKSGPVLSQKG 991


>01_01_0722 + 5639760-5640101
          Length = 113

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +1

Query: 40  PRGHKTGPELRQPPSSAGRGPQREARRVGLPTELSS 147
           P  H   PEL  PP+++G   QR+ R  G  T+ S+
Sbjct: 46  PEVHWAVPELPSPPTASGLHWQRDPRYGGGATDASA 81


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,019,837
Number of Sequences: 37544
Number of extensions: 501858
Number of successful extensions: 1813
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 1712
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1810
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1376330256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).