SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0006
         (852 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_08_0005 + 27536091-27536761,27539697-27539890,27540097-275402...    32   0.50 
05_03_0013 + 7362056-7362471,7363235-7364081,7364272-7364758,736...    29   4.7  
11_06_0719 + 26612152-26612856,26613102-26613110,26614272-26615198     29   6.2  

>11_08_0005 +
           27536091-27536761,27539697-27539890,27540097-27540255,
           27540385-27541493
          Length = 710

 Score = 32.3 bits (70), Expect = 0.50
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +1

Query: 667 MATKRSVFALILFTCSAGRHARRASWRTNGSRVRSGNSVIHHTQFD 804
           +AT   V  L+ F C   R  RR  +  NG R+ SG  + H ++ D
Sbjct: 341 LATVCIVIFLVFFVCWYERRKRRRHFNNNGGRLLSGMEIKHFSKKD 386


>05_03_0013 +
           7362056-7362471,7363235-7364081,7364272-7364758,
           7365062-7365126,7365275-7365643
          Length = 727

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +2

Query: 428 DTAIVFKKKNTKNNGVFTRFVV*KRYTLREIRLQKWRYATV 550
           D A+ F+ +  KNN   T F    + T R++R++K RY+ V
Sbjct: 674 DFALEFRNRRLKNNSNSTEFWNNFQPTERQLRIRKRRYSIV 714


>11_06_0719 + 26612152-26612856,26613102-26613110,26614272-26615198
          Length = 546

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 13/25 (52%), Positives = 15/25 (60%)
 Frame = -2

Query: 788 WITLFPDRTRDPLVRHDARLACRPA 714
           W  L  D+   P+V HD RLA RPA
Sbjct: 251 WSALPRDKYPKPMVFHDGRLAFRPA 275


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,202,391
Number of Sequences: 37544
Number of extensions: 320395
Number of successful extensions: 663
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 635
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 648
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2373961368
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).