SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0004
         (717 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731...   277   8e-75
01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782...   275   2e-74
05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32...   274   3e-74
03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137...   274   6e-74
12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323...   272   1e-73
10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910...   268   4e-72
01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054...   266   9e-72
05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585...   264   5e-71
11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306...   258   2e-69
12_02_1282 + 27528159-27529148,27529549-27529614                      201   5e-52
03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324...   118   5e-27
08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207...   115   4e-26
01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931...   101   8e-22
08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981...    90   2e-18
01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238...    83   2e-16
04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182...    83   2e-16
08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160...    77   1e-14
02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980...    75   7e-14
11_03_0057 + 9375083-9375088,9375904-9376031,9376107-9376166,937...    33   0.30 
05_01_0311 + 2452230-2452232,2452401-2452809,2454136-2454263,245...    31   0.69 
08_02_0238 + 14665813-14668798,14669088-14669125                       29   3.7  
07_03_0752 - 21241883-21242233,21242336-21242486,21242586-212428...    29   3.7  
03_05_0807 + 27849637-27849823,27850002-27850294,27850736-278509...    29   3.7  
07_03_0008 + 12303536-12303893,12303910-12304176,12304635-123049...    29   4.9  
02_02_0520 + 11152718-11153600,11153736-11153917,11154160-111542...    28   6.4  
01_06_1741 + 39581656-39581680,39582627-39582697,39582779-395828...    28   6.4  
01_06_1020 + 33878391-33878582,33879194-33879271,33879363-338795...    28   8.5  

>03_05_0926 +
           28871800-28871859,28871943-28872336,28872586-28873199,
           28873281-28873346
          Length = 377

 Score =  277 bits (678), Expect = 8e-75
 Identities = 126/140 (90%), Positives = 133/140 (95%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKSYELPDGQVITIG ERFRCPE LFQPSF+GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 VEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+K EYDESGPSIVHRKCF
Sbjct: 358 WIAKAEYDESGPSIVHRKCF 377


>01_07_0285 -
           42476767-42476832,42476990-42477603,42477821-42478214,
           42478301-42478360
          Length = 377

 Score =  275 bits (675), Expect = 2e-74
 Identities = 124/140 (88%), Positives = 133/140 (95%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKSYELPDGQVITIG+ERFRCPE LFQPS +GME+ GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 IEKSYELPDGQVITIGSERFRCPEVLFQPSMIGMESAGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NVVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDESGP+IVHRKCF
Sbjct: 358 WISKDEYDESGPAIVHRKCF 377


>05_01_0047 -
           323097-323162,323287-323900,324233-324626,324718-324777
          Length = 377

 Score =  274 bits (673), Expect = 3e-74
 Identities = 125/140 (89%), Positives = 132/140 (94%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKSYELPDGQVITIG ERFRCPE LFQPS +GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 VEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDESGP+IVHRKCF
Sbjct: 358 WISKDEYDESGPAIVHRKCF 377


>03_06_0585 -
           34912159-34912224,34912634-34913247,34913350-34913734,
           34913824-34913883
          Length = 374

 Score =  274 bits (671), Expect = 6e-74
 Identities = 126/140 (90%), Positives = 132/140 (94%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKSYELPDGQVITIG ERFRCPE LFQPS +GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 235 VEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAPGIHETTYNSIMKCDVDIRKDLYG 294

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 295 NIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 354

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDESGPSIVHRKCF
Sbjct: 355 WISKGEYDESGPSIVHRKCF 374


>12_01_0409 -
           3230853-3230918,3231372-3231994,3232454-3232847,
           3233000-3233059
          Length = 380

 Score =  272 bits (668), Expect = 1e-73
 Identities = 124/140 (88%), Positives = 132/140 (94%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKSYELPDGQVITIG ERFRCPE LFQPS +GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 241 VEKSYELPDGQVITIGAERFRCPEVLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYG 300

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 301 NVVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 360

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDESGP+IVHRKCF
Sbjct: 361 WISKAEYDESGPAIVHRKCF 380


>10_08_0597 +
           19089616-19089675,19089789-19090182,19090451-19091064,
           19091160-19091225
          Length = 377

 Score =  268 bits (656), Expect = 4e-72
 Identities = 121/140 (86%), Positives = 132/140 (94%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKSYELPDGQVITIG ERFRCPE +FQPS +GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 VEKSYELPDGQVITIGAERFRCPEVMFQPSLIGMEAPGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WIS+ EY+ESGP+IVHRKCF
Sbjct: 358 WISRAEYEESGPAIVHRKCF 377


>01_06_1455 +
           37504175-37504231,37504357-37504750,37504865-37505478,
           37506021-37506086
          Length = 376

 Score =  266 bits (653), Expect = 9e-72
 Identities = 121/140 (86%), Positives = 128/140 (91%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKSYELPDGQVITIG ERFRCPE LFQPSF+GMEA GIHE TYNSIMKCDVDIRKDLY 
Sbjct: 237 IEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAPGIHEATYNSIMKCDVDIRKDLYG 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGG+TM+PGI DRM KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NVVLSGGSTMFPGIGDRMSKEITALAPGSMKIKVVAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDESGP IVH KCF
Sbjct: 357 WISKAEYDESGPGIVHMKCF 376


>05_04_0450 -
           21356877-21356942,21357482-21358095,21358173-21358566,
           21358648-21358704
          Length = 376

 Score =  264 bits (647), Expect = 5e-71
 Identities = 119/140 (85%), Positives = 130/140 (92%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKSYE+PDGQVITIG+ERFRCPE LFQPS +GME+ GIHE TYNSIMKCDVDIRKDLY 
Sbjct: 237 VEKSYEMPDGQVITIGSERFRCPEVLFQPSLVGMESPGIHEATYNSIMKCDVDIRKDLYG 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGG+TM+PGIADRM KEIT+LAPS+MK+K+IAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NVVLSGGSTMFPGIADRMSKEITSLAPSSMKVKVIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDESGP IVH KCF
Sbjct: 357 WISKGEYDESGPGIVHMKCF 376


>11_01_0403 +
           3059650-3059709,3059807-3060200,3060275-3060930,
           3060979-3061044
          Length = 391

 Score =  258 bits (633), Expect = 2e-69
 Identities = 125/154 (81%), Positives = 133/154 (86%), Gaps = 14/154 (9%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKSYELPDGQVITIG ERFRCPE LFQPSF+GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 VEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAPGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQ-- 353
           N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQ  
Sbjct: 298 NIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQV 357

Query: 352 ------------QMWISKQEYDESGPSIVHRKCF 287
                       QMWISK EYDESGP+IVHRKCF
Sbjct: 358 NLTPTLYEVARMQMWISKGEYDESGPAIVHRKCF 391


>12_02_1282 + 27528159-27529148,27529549-27529614
          Length = 351

 Score =  201 bits (490), Expect = 5e-52
 Identities = 103/143 (72%), Positives = 108/143 (75%)
 Frame = -3

Query: 715 GPPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           G  +EKSYELPDGQVITIG ERFRCPE LFQPSF+GMEA GIHETTYNSIMKCDVDIRKD
Sbjct: 235 GSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKD 294

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 356
           LY N VLSGGTTM+PGIADRM KEITALAPS+MKIK                        
Sbjct: 295 LYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIK------------------------ 330

Query: 355 QQMWISKQEYDESGPSIVHRKCF 287
             MWI+K EYDESGPSIVHRKCF
Sbjct: 331 --MWIAKAEYDESGPSIVHRKCF 351


>03_06_0192 +
           32230953-32231030,32231130-32231485,32232250-32232425,
           32233857-32234038,32234260-32234443,32235192-32235259,
           32235343-32235495
          Length = 398

 Score =  118 bits (284), Expect = 5e-27
 Identities = 62/142 (43%), Positives = 83/142 (58%), Gaps = 6/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           + LPDGQVITI  ER+   EALFQP  LG+E  GI      S+     +  + L  NT+L
Sbjct: 258 HTLPDGQVITIEKERYIVGEALFQPHILGLEDYGIVHQLVTSVSNVTPEYHRQLLENTML 317

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE------RKYSVWIGGSILASLSTFQ 353
            GGT    G  DR Q+E   L+ S +   ++ PPE       +YS W+GG+ILA +   Q
Sbjct: 318 CGGTASMTGFEDRFQREAN-LSASAICPSLVKPPEYMPENLARYSAWLGGAILAKVVFPQ 376

Query: 352 QMWISKQEYDESGPSIVHRKCF 287
              ++K +YDE+GPSIVH+KCF
Sbjct: 377 NQHVTKGDYDETGPSIVHKKCF 398


>08_01_0254 +
           2078380-2078392,2078487-2078578,2079579-2079698,
           2079924-2080097,2080184-2080257,2080847-2080927,
           2081306-2081366,2081437-2081486,2082278-2082332,
           2082599-2082676,2082757-2082810,2083703-2083756,
           2083846-2083906,2084229-2084280,2085118-2085184,
           2085393-2085452,2085546-2085608,2085752-2085814,
           2086337-2086401,2086620-2086688,2086742-2086847
          Length = 503

 Score =  115 bits (276), Expect = 4e-26
 Identities = 58/137 (42%), Positives = 86/137 (62%), Gaps = 14/137 (10%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFL-----------GMEACGIHETTYNSIMKCDV 551
           SYELPDGQ I +G +RF+ P+ LF PS              M   G+     +S+ +CDV
Sbjct: 333 SYELPDGQTIEVGADRFKIPDILFNPSLSQTIPGVDGFADSMSVRGLPRMVIDSVNRCDV 392

Query: 550 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGS 380
           DIRK+L ++ +LSGG++    + +R++KE+   +    ++K++A     ER++SVWIGGS
Sbjct: 393 DIRKELLSSILLSGGSSSILQLKERLEKEVLEESSGNTRVKVLASGNSVERRFSVWIGGS 452

Query: 379 ILASLSTFQQMWISKQE 329
           ILASL +FQQMW SK +
Sbjct: 453 ILASLGSFQQMWFSKAD 469


>01_01_1170 -
           9318332-9318461,9318551-9318613,9318694-9318744,
           9318837-9318921,9319005-9319068,9319139-9319340,
           9319808-9320502
          Length = 429

 Score =  101 bits (241), Expect = 8e-22
 Identities = 50/139 (35%), Positives = 76/139 (54%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           +K  EL   + + + NERF  PE LF P  LGM   G+ E    +I  C   ++  L+  
Sbjct: 291 KKKPELSQNEFV-LTNERFLVPEMLFHPIDLGMNQAGLAECIVRAIQACHPHLQPVLFER 349

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW 344
            +L+GG+T++P   +R++KE+  L P   ++KIIA  +     W GGS+LA    F+ M 
Sbjct: 350 IILTGGSTLFPRFTERLEKELRPLVPDDYQVKIIAQEDPILGAWRGGSLLAHRPDFESMC 409

Query: 343 ISKQEYDESGPSIVHRKCF 287
           I+K EY+E G     R+ F
Sbjct: 410 ITKSEYEEMGSMRCRRRFF 428


>08_02_0441 -
           17196352-17196536,17196780-17196906,17198018-17198101,
           17198282-17198348,17198575-17198633,17199211-17199336,
           17199406-17199474,17199545-17199653,17199692-17199760,
           17199876-17199979,17200518-17200567,17200696-17200774,
           17200867-17200938,17201083-17201217,17201311-17201421,
           17202088-17202129
          Length = 495

 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 52/139 (37%), Positives = 79/139 (56%), Gaps = 25/139 (17%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPS--------------FLGMEACGIHETTYNS 569
           L KSY LPDG+VI +G ERF+ PEALF P                + +E  G+ +  +  
Sbjct: 252 LVKSYTLPDGRVIKVGTERFQAPEALFTPDQYQHNIDKTFVEQELIDVEGDGMADMAFRC 311

Query: 568 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEI------TALAPS-----TMKIKII 422
           I + D+D R  LY + VLSGG+TMYPG+  R++KE+        L  +      ++++I 
Sbjct: 312 IQEMDIDNRMTLYQHIVLSGGSTMYPGLPSRLEKEMLDRYLDVVLKGNKDGLKKLRLRIE 371

Query: 421 APPERKYSVWIGGSILASL 365
            PP RK+ V++GG++LA +
Sbjct: 372 DPPRRKHMVYLGGAVLAGI 390


>01_01_0292 -
           2387653-2387711,2388061-2388684,2388814-2389104,
           2389338-2389390,2390496-2390968,2391090-2391432,
           2391793-2391911,2392081-2392512,2392657-2392747,
           2392833-2392942,2393681-2393875,2394581-2394622,
           2395144-2395268,2395856-2395926,2396047-2396147
          Length = 1042

 Score = 83.4 bits (197), Expect = 2e-16
 Identities = 44/142 (30%), Positives = 75/142 (52%), Gaps = 2/142 (1%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC--DVDIRK 539
           PP  ++    D + I+IG ERFRCPE LFQP  +G++  GI E    S+ +   D  +++
Sbjct: 562 PPKVRTLTAEDYR-ISIGIERFRCPEILFQPGMIGIDQAGIDEMVSISLRRLMEDEAVKE 620

Query: 538 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLST 359
            L  + +++GG ++ PG+  R++  I    P    +K++   +     W G +  A+ S 
Sbjct: 621 RLCQSILVTGGCSLIPGMIPRLESGIRQFRPYLSPLKLVRAADPLIDAWRGAAAFAASSK 680

Query: 358 FQQMWISKQEYDESGPSIVHRK 293
           F +   S  +Y E G ++ HRK
Sbjct: 681 FGRHTFSLADYREHGENLFHRK 702


>04_04_1515 +
           34117383-34117732,34117833-34117918,34118227-34118297,
           34118457-34118524,34118692-34118753,34119010-34119107,
           34119545-34119626,34119935-34120077,34120233-34120381,
           34120461-34120594,34120714-34120832,34120926-34121014,
           34121398-34121515
          Length = 522

 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 45/133 (33%), Positives = 77/133 (57%), Gaps = 10/133 (7%)
 Frame = -3

Query: 667 TIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC---DVDIRKDLYANTVLSGGTTM 497
           T+  ERF+  E LFQP   G+ A G+H+     +  C   +V    + Y   VLSGG++ 
Sbjct: 350 TLSEERFKTAEILFQPQIGGVRAMGLHKAVSLCMDHCYNSEVFGDDNWYKTVVLSGGSSC 409

Query: 496 YPGIADRMQKEITALAPSTMK--IKIIAPPERKYSVWIGGSILASLSTFQQMW-ISKQEY 326
            PG+++R++KE+  L P+ +   I++I PP    S W G  +++++STF + W I K+++
Sbjct: 410 LPGLSERLEKELRELLPAHISEGIRVIPPPFGTDSAWFGAKMISNVSTFTEAWCIKKKQF 469

Query: 325 DE----SGPSIVH 299
            +    +GPS V+
Sbjct: 470 RQKTRRNGPSFVN 482


>08_01_0194 -
           1603702-1603782,1603970-1604062,1604203-1604328,
           1604403-1604513,1604989-1605108,1605665-1605757,
           1606024-1606157,1606503-1606530,1606821-1607075,
           1607167-1607401,1608147-1608193
          Length = 440

 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 44/137 (32%), Positives = 68/137 (49%), Gaps = 15/137 (10%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           I IG ERF  PE  F P     + +  + E   + +    +D R+DLY N VLSGG+TM+
Sbjct: 293 IDIGYERFLGPEIFFHPEIYSADFSTPLPELIDSCVQSAPIDTRRDLYKNIVLSGGSTMF 352

Query: 493 PGIADRMQKEITALAP--------------STMKIKIIAPPERKYSVWIGGSILASLSTF 356
                R+Q +I  +                  +++ ++A P + Y+ W GGS+ AS   F
Sbjct: 353 KDFHKRLQNDIKKIVDERVAATNARHHVEVKPVEVNVVAHPIQSYAAWFGGSVAASNPEF 412

Query: 355 QQMWISKQEYDESGPSI 305
            +   +K+EY+E G SI
Sbjct: 413 YESCHTKEEYEEHGASI 429


>02_04_0473 +
           23197294-23197340,23197443-23197680,23197792-23198016,
           23198616-23198762,23198827-23198961,23199415-23199507,
           23199925-23200044,23200303-23200413,23200486-23200611,
           23200731-23200829,23201024-23201104
          Length = 473

 Score = 74.5 bits (175), Expect = 7e-14
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 17/137 (12%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPG 488
           IG ERF  PE  F P     +    +H      I    +D R+ LY N VLSGG+TM+  
Sbjct: 326 IGYERFLGPEIFFHPEIYNNDFTTPLHVVIDKCIQSSPIDTRRALYKNIVLSGGSTMFKD 385

Query: 487 IADRMQKEITALAPS----------------TMKIKIIAPPERKYSVWIGGSILASLSTF 356
              R+Q+++  +  +                 +++ +++ P ++Y+VW GGS+LAS + F
Sbjct: 386 FHRRLQRDLKKIVDARVLASNARLGGDAKAQPIEVNVVSHPIQRYAVWFGGSVLASTAEF 445

Query: 355 QQMWISKQEYDESGPSI 305
            +   +K EY+E G SI
Sbjct: 446 YEACHTKAEYEEYGASI 462


>11_03_0057 +
           9375083-9375088,9375904-9376031,9376107-9376166,
           9376832-9376892,9377434-9377583,9377667-9377822,
           9377905-9378116,9378572-9378673,9378785-9378924,
           9379781-9379932
          Length = 388

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 21/75 (28%), Positives = 34/75 (45%)
 Frame = -3

Query: 592 IHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP 413
           I E  Y  I++   ++ ++    T  +G   MYP   D  +K+   L     K    APP
Sbjct: 226 IRELIYRDILEYHPNMLREYLEGTESAG--FMYPSAVDHFKKQFAYLEEHYAKGSTAAPP 283

Query: 412 ERKYSVWIGGSILAS 368
           ER+++     S+L S
Sbjct: 284 ERQHNSLPRPSVLYS 298


>05_01_0311 +
           2452230-2452232,2452401-2452809,2454136-2454263,
           2455287-2455436,2455526-2455681,2455775-2455986,
           2456306-2456407,2456517-2456653,2456769-2457055
          Length = 527

 Score = 31.5 bits (68), Expect = 0.69
 Identities = 18/65 (27%), Positives = 29/65 (44%)
 Frame = -3

Query: 592 IHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP 413
           I E  Y  I++    + ++    T  +G   MYP   D  +K+   L     K    APP
Sbjct: 321 IRELIYREILEYHPKMLREFLEGTESTG--FMYPSAVDHFKKQFAYLEEHYAKGSTAAPP 378

Query: 412 ERKYS 398
           ER+++
Sbjct: 379 ERQHN 383


>08_02_0238 + 14665813-14668798,14669088-14669125
          Length = 1007

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 1/27 (3%)
 Frame = +2

Query: 383 STDPYGVLPLWRSNDLNLHCRW-GESC 460
           S DP G L  W+ ND    CRW G +C
Sbjct: 62  SNDPGGFLGSWKQNDSIGFCRWPGVTC 88


>07_03_0752 -
           21241883-21242233,21242336-21242486,21242586-21242823,
           21242917-21243127,21243214-21243344,21245046-21245931,
           21246087-21246140,21246397-21246461,21246842-21246892,
           21246960-21247029,21247493-21247597
          Length = 770

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = +3

Query: 252 RAAGGSDARCV*KHFLCTMEGPDS 323
           RAAGG  ARC+    LC  E P S
Sbjct: 675 RAAGGEIARCIHVGLLCVQENPAS 698


>03_05_0807 +
           27849637-27849823,27850002-27850294,27850736-27850973,
           27851075-27851410,27851496-27851581,27851678-27851785,
           27851878-27852185,27852265-27852528,27852610-27853381
          Length = 863

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = -1

Query: 690 NFPTVRSSLSETKDSVAQRLSSNPRSWVWKLA 595
           + P +  +L+  K  V    SS   SWVW+LA
Sbjct: 470 SLPHIEGNLTSAKSKVHTPASSGIESWVWQLA 501


>07_03_0008 +
           12303536-12303893,12303910-12304176,12304635-12304951,
           12304975-12305819,12305859-12306069
          Length = 665

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 4/40 (10%)
 Frame = +3

Query: 252 RAAGGSDARCV*KHFLCTM----EGPDSSYSCFEIHICWK 359
           RA G     CV + FLCT+    +G +    C E H+ WK
Sbjct: 301 RALGWDKFACVDEPFLCTLLKVGDGVNFRLFCKEYHLSWK 340


>02_02_0520 +
           11152718-11153600,11153736-11153917,11154160-11154249,
           11154343-11154627,11154776-11154994,11155112-11155339
          Length = 628

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 13/27 (48%), Positives = 20/27 (74%), Gaps = 2/27 (7%)
 Frame = -3

Query: 703 EKSY-ELPDGQ-VITIGNERFRCPEAL 629
           +K Y +L  G+ V+++GNE+FRCP  L
Sbjct: 20  DKCYMDLKSGKPVVSLGNEKFRCPFCL 46


>01_06_1741 +
           39581656-39581680,39582627-39582697,39582779-39582898,
           39583034-39583094,39583186-39583242,39583413-39583600,
           39583747-39583818,39583953-39584180
          Length = 273

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 16/61 (26%), Positives = 27/61 (44%)
 Frame = -1

Query: 405 STPYGSVDRSSPPSLPSNRCGSRNRSTTSLAPPLYTGSASKRTARRCLQQPAAGCSIQAC 226
           +TPY +      P   +N    ++     +A P     A KRTA   + + +AG + + C
Sbjct: 214 ATPYPAKQAKKTPV--NNDMAKQSSGYVHVATPYPAKQAKKRTANNDMSEHSAGYACKPC 271

Query: 225 N 223
           N
Sbjct: 272 N 272


>01_06_1020 +
           33878391-33878582,33879194-33879271,33879363-33879524,
           33879789-33880106,33880477-33880671
          Length = 314

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%)
 Frame = -3

Query: 715 GPPLEKSYE-LPDGQVITIGNERFRCPEALFQPSF 614
           GP +EKS   LP+G V+ + N RF   E    P F
Sbjct: 99  GPEVEKSVSVLPNGSVLLLENVRFYKEEEKNDPEF 133


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,891,670
Number of Sequences: 37544
Number of extensions: 477820
Number of successful extensions: 1430
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 1375
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1419
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1862792824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).