SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0002
         (698 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_1500 + 34010819-34011016,34013267-34013308,34014195-340142...    28   8.2  
01_05_0005 - 16886553-16886946,16887079-16887404                       28   8.2  

>04_04_1500 +
           34010819-34011016,34013267-34013308,34014195-34014204,
           34014526-34014586,34014621-34014678,34015266-34015412,
           34015643-34016205,34018942-34019728
          Length = 621

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%)
 Frame = -1

Query: 626 PARGGSDEKYRYGTLTRPRNRNEYTLNI--LTRNNWRAS 516
           P RGG  +KY  G  +RP    +   +   L R NW A+
Sbjct: 197 PTRGGGGKKYAIGYRSRPEKSKKRIASFMKLLRFNWAAA 235


>01_05_0005 - 16886553-16886946,16887079-16887404
          Length = 239

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = +3

Query: 459 RNNFSIRYWSWNYRGC 506
           R+N S RYW W   GC
Sbjct: 90  RSNSSFRYWRWQPHGC 105


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,040,218
Number of Sequences: 37544
Number of extensions: 356369
Number of successful extensions: 725
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 715
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 725
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1792053856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).