SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0001
         (944 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_01_0604 - 4491884-4491993,4493030-4493225,4494269-4494326,449...   110   1e-24
03_06_0314 - 33077621-33077869,33078218-33078280,33079392-330794...    90   2e-18

>07_01_0604 -
           4491884-4491993,4493030-4493225,4494269-4494326,
           4494459-4494613,4495092-4495115,4495377-4495489,
           4499943-4500129
          Length = 280

 Score =  110 bits (265), Expect = 1e-24
 Identities = 51/76 (67%), Positives = 61/76 (80%)
 Frame = +2

Query: 455 SEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEM 634
           ++ L++L           GLKRKPMAL+KKLR+AKK+AP  EKPE V+THLRNMIIVPEM
Sbjct: 146 TDDLVQLFPARARRRFQRGLKRKPMALIKKLRKAKKDAPAGEKPEPVRTHLRNMIIVPEM 205

Query: 635 VGSIVGIYNGKTFNQV 682
           +GSIVG+YNGKTFNQV
Sbjct: 206 IGSIVGVYNGKTFNQV 221



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 17/21 (80%), Positives = 19/21 (90%)
 Frame = +3

Query: 177 KKRIFRKFTYRGVDLDQLLDM 239
           KKR FRK++YRGVDLD LLDM
Sbjct: 124 KKRTFRKYSYRGVDLDALLDM 144


>03_06_0314 -
           33077621-33077869,33078218-33078280,33079392-33079449,
           33079534-33079688,33079797-33080106,33080634-33080890,
           33081280-33081359,33083888-33083948
          Length = 410

 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 51/97 (52%), Positives = 61/97 (62%), Gaps = 21/97 (21%)
 Frame = +2

Query: 455 SEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRA---------------------KKEAP 571
           ++ L++L           GLKRKPMAL+KKLR+A                     KK+AP
Sbjct: 274 TDDLVQLFPARARRRFQRGLKRKPMALIKKLRKAGSNFEGTVFRLGFYEAGSYFVKKDAP 333

Query: 572 PNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQV 682
             EKPE V+THLRNMIIVPEM+GSIVG+YNGKTFNQV
Sbjct: 334 AGEKPEPVRTHLRNMIIVPEMIGSIVGVYNGKTFNQV 370



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 17/21 (80%), Positives = 19/21 (90%)
 Frame = +3

Query: 177 KKRIFRKFTYRGVDLDQLLDM 239
           KKR FRK++YRGVDLD LLDM
Sbjct: 252 KKRTFRKYSYRGVDLDALLDM 272


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,967,525
Number of Sequences: 37544
Number of extensions: 368003
Number of successful extensions: 699
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 685
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 699
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2717819680
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).