SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0044
         (613 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_04_0143 + 17670103-17670430,17670511-17670785,17670897-176713...    30   1.3  
10_08_0459 + 18092656-18092724,18092827-18092886,18092970-180930...    29   2.9  
03_02_0680 + 10351625-10351824,10352224-10352266,10352477-103525...    29   2.9  
07_03_0591 + 19792694-19792738,19794190-19794509,19795104-197951...    29   3.8  
06_03_0561 - 22183140-22183185,22183273-22183442,22183554-221836...    29   3.8  
07_01_0024 + 159839-159923,160395-160442,160884-160895,161347-16...    28   5.1  
04_04_0585 - 26386248-26386271,26386510-26386699,26387363-263874...    28   5.1  
04_03_0362 + 14934236-14934541,14935549-14935647,14935736-149357...    28   5.1  

>03_04_0143 +
           17670103-17670430,17670511-17670785,17670897-17671376,
           17671454-17671849,17673215-17673289,17673939-17673960,
           17674041-17674129,17675204-17675495,17676019-17676087,
           17676394-17676572
          Length = 734

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +1

Query: 331 NGVVEPGLTAIRVLIVAGRTRDRIHDQQLRRGSS 432
           +GVV+P +    VL+V   TR RI   ++RRG++
Sbjct: 603 SGVVKPSIHCFYVLVVLFDTRRRIQMMKMRRGTT 636


>10_08_0459 +
           18092656-18092724,18092827-18092886,18092970-18093038,
           18093134-18093178,18093706-18094332,18094424-18094597,
           18094688-18094991,18095070-18095161,18095253-18095319,
           18095407-18095478,18095613-18095830,18095979-18096113,
           18096225-18096520,18096603-18096774,18096860-18096958,
           18097048-18097179,18097273-18097373,18097460-18097649,
           18097713-18097751
          Length = 986

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 14/60 (23%), Positives = 27/60 (45%)
 Frame = +1

Query: 226 IVKLFCTVIFNNKHPVFEIQRGIFLSFVRHGVKRPNGVVEPGLTAIRVLIVAGRTRDRIH 405
           ++ +FC V+F + HP    +   FLS    G +  N + + GL  ++          ++H
Sbjct: 773 VISVFCRVLFQDSHPSKSKRNYFFLSI---GAELINDISDKGLEKVKKSFEGATNARKLH 829


>03_02_0680 +
           10351625-10351824,10352224-10352266,10352477-10352530,
           10353122-10353185,10353385-10353441,10353516-10353610,
           10353836-10353924,10354022-10354100,10355193-10355240,
           10356675-10356767
          Length = 273

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +2

Query: 425 GLVSKLIKPKTVVQFYISCFSTIKHAT 505
           G+V K+   K  +  YI C ST+ HAT
Sbjct: 147 GVVVKMFSSKCSISVYIYCDSTVAHAT 173


>07_03_0591 +
           19792694-19792738,19794190-19794509,19795104-19795161,
           19798000-19798056,19798373-19798440,19798454-19798543,
           19798619-19798820,19798902-19798988,19799642-19799719,
           19799815-19800040,19800260-19800483,19801988-19802014,
           19802470-19802518,19802594-19802688,19802778-19802864,
           19802973-19803100,19803198-19803294,19803563-19803788,
           19803888-19804294
          Length = 856

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +3

Query: 168 VVTSFIILHIYNEYTFVIHYC 230
           V+TSFII H+ NE+  V   C
Sbjct: 808 VITSFIIFHVKNEFLLVTALC 828


>06_03_0561 -
           22183140-22183185,22183273-22183442,22183554-22183619,
           22183911-22184010,22184072-22184164,22184259-22184352,
           22185029-22185257,22185460-22185556,22187406-22187710
          Length = 399

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = +3

Query: 324 AAERGRRTRS-NCDSRVDRGRPHTRSNSRPT 413
           A ERG+R  S  C + VDR RP T S   P+
Sbjct: 129 AIERGKRIASVQCSALVDRWRPETHSFHLPS 159


>07_01_0024 + 159839-159923,160395-160442,160884-160895,161347-161427,
            161530-161675,161918-161965,162054-162203,165647-165706,
            165788-165859,165960-166409,166640-166839,167239-168236,
            168676-168683,169057-169230,169341-169659,169748-169824,
            169897-169966,170040-170111,170204-170418,170540-170665,
            170751-171046,171133-171157,171163-171303,171400-171498,
            171571-171702,171793-171912
          Length = 1407

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 8/15 (53%), Positives = 12/15 (80%)
 Frame = +1

Query: 226  IVKLFCTVIFNNKHP 270
            ++ +FC V+FNN HP
Sbjct: 1264 VINVFCRVLFNNNHP 1278


>04_04_0585 - 26386248-26386271,26386510-26386699,26387363-26387463,
            26387554-26387685,26387759-26387857,26387956-26388127,
            26388217-26388512,26388601-26388726,26388848-26389062,
            26389154-26389225,26389299-26389368,26389441-26389517,
            26389605-26389923,26390034-26390225,26390321-26390551,
            26390585-26390950,26392251-26392313,26392394-26392456,
            26392544-26392642,26393497-26393523,26394299-26394358,
            26395230-26396147,26396243-26397268
          Length = 1645

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 8/15 (53%), Positives = 12/15 (80%)
 Frame = +1

Query: 226  IVKLFCTVIFNNKHP 270
            ++ +FC V+FNN HP
Sbjct: 1437 VINVFCRVLFNNNHP 1451


>04_03_0362 +
           14934236-14934541,14935549-14935647,14935736-14935798,
           14935878-14935940,14937242-14937362,14937472-14937872,
           14937968-14938141,14938252-14938570,14938659-14938735,
           14938808-14938877,14938951-14939007,14939100-14939314,
           14939436-14939561,14939649-14939944,14940032-14940203,
           14940300-14940398,14940471-14940602,14940692-14940792,
           14941391-14941580,14941819-14941842
          Length = 1034

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 8/15 (53%), Positives = 12/15 (80%)
 Frame = +1

Query: 226 IVKLFCTVIFNNKHP 270
           ++ +FC V+FNN HP
Sbjct: 826 VINVFCRVLFNNNHP 840


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,263,436
Number of Sequences: 37544
Number of extensions: 259087
Number of successful extensions: 600
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 599
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 600
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1466594128
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).