SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0042
         (619 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_1344 - 29472139-29473292,29474478-29475386,29475504-294756...    28   5.2  
03_01_0028 - 274231-275424                                             28   6.8  
02_01_0087 + 623174-623421,623576-623693,624266-624588,625267-62...    27   9.0  

>06_03_1344 -
           29472139-29473292,29474478-29475386,29475504-29475618,
           29476017-29476218,29477177-29477296,29477431-29477582,
           29478177-29478461
          Length = 978

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +1

Query: 298 SHRSLRNTIHSQYCSDSSFPESTRYSG 378
           S+R  R +   +Y SDSS PE  R+SG
Sbjct: 515 SNRHSRRSREKRYYSDSSSPEHNRHSG 541


>03_01_0028 - 274231-275424
          Length = 397

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = -2

Query: 603 PFISEVNISFTVKKI*AFYPLSQIITVWHNVCN 505
           PF+S+    FT  KI ++  +   I + HN CN
Sbjct: 207 PFVSDRTCCFTYPKITSYAVVGSNICISHNSCN 239


>02_01_0087 +
           623174-623421,623576-623693,624266-624588,625267-625551,
           625643-625823,625964-626119
          Length = 436

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 2/64 (3%)
 Frame = +2

Query: 155 YYA*EKLHWPFDCRVGHRCPTRRTEVIMSISVTR--RLHGLLLFVNVCFSLIDLLEIRFI 328
           YY     HW F         T     I  I  +R  RL GL+++V   +S++   E RF+
Sbjct: 268 YYGTHVFHWYFSQGFPSMIWTFLPFSISGIMKSREWRLAGLIVWVLAVYSILGHKEFRFV 327

Query: 329 LSIV 340
           L ++
Sbjct: 328 LPVL 331


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,615,693
Number of Sequences: 37544
Number of extensions: 280331
Number of successful extensions: 496
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 488
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 496
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1490248872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).