SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0039
         (616 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731...   188   4e-48
11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306...   186   2e-47
05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32...   186   2e-47
01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782...   186   2e-47
12_02_1282 + 27528159-27529148,27529549-27529614                      185   2e-47
01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054...   184   4e-47
03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137...   184   5e-47
10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910...   183   9e-47
12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323...   182   2e-46
05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585...   182   2e-46
08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981...    97   1e-20
08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160...    93   2e-19
02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980...    89   3e-18
08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207...    81   9e-16
04_03_0738 + 19169764-19169897,19169987-19170116,19170614-191706...    52   5e-07
01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931...    47   1e-05
01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238...    45   6e-05
07_03_0401 + 17724103-17724463,17724554-17724683,17725068-177250...    43   2e-04
07_03_0143 - 14315097-14315130,14315594-14315662,14316152-143162...    40   0.002
03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093     33   0.14 
09_04_0660 - 19286653-19287271,19287791-19287916,19288016-192882...    29   3.9  
03_01_0470 + 3619417-3619572,3619681-3619759,3620017-3620258,362...    29   3.9  
02_05_0713 + 31159574-31160764                                         29   3.9  
02_01_0288 + 1932171-1932188,1932264-1933280                           29   3.9  
03_06_0331 - 33181757-33181795,33182325-33182453,33182941-331829...    28   5.1  
02_04_0179 + 20682852-20684510,20684593-20684661,20684741-206848...    28   5.1  
08_01_1006 - 10191817-10191822,10192449-10192745,10192826-101929...    28   6.8  
03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324...    28   6.8  
03_06_0030 + 31161821-31161927,31163700-31163934,31164064-311648...    28   6.8  
02_02_0572 + 11667455-11670783,11672026-11672419                       28   6.8  
01_06_0946 + 33220910-33222221,33223373-33223734,33223863-332240...    28   6.8  
01_06_0027 - 25742122-25742310,25742481-25742553,25743219-25744159     28   6.8  
12_02_0800 + 23299674-23299678,23299714-23299791,23299876-232999...    27   8.9  
12_01_0843 + 7891622-7892524                                           27   8.9  
10_07_0100 + 12861588-12862601                                         27   8.9  
08_01_0855 + 8407411-8407628,8408231-8408267                           27   8.9  
07_03_0207 - 15183894-15184685,15184993-15185078,15186042-151861...    27   8.9  
03_05_0943 + 29034398-29034512,29035059-29035508,29035654-29035826     27   8.9  
02_05_0477 - 29339649-29340253,29340880-29341492                       27   8.9  
02_01_0370 + 2659704-2660012,2660318-2660488,2660981-2661058,266...    27   8.9  

>03_05_0926 +
           28871800-28871859,28871943-28872336,28872586-28873199,
           28873281-28873346
          Length = 377

 Score =  188 bits (457), Expect = 4e-48
 Identities = 92/119 (77%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>11_01_0403 +
           3059650-3059709,3059807-3060200,3060275-3060930,
           3060979-3061044
          Length = 391

 Score =  186 bits (452), Expect = 2e-47
 Identities = 91/119 (76%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>05_01_0047 -
           323097-323162,323287-323900,324233-324626,324718-324777
          Length = 377

 Score =  186 bits (452), Expect = 2e-47
 Identities = 91/119 (76%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>01_07_0285 -
           42476767-42476832,42476990-42477603,42477821-42478214,
           42478301-42478360
          Length = 377

 Score =  186 bits (452), Expect = 2e-47
 Identities = 91/119 (76%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>12_02_1282 + 27528159-27529148,27529549-27529614
          Length = 351

 Score =  185 bits (451), Expect = 2e-47
 Identities = 91/119 (76%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 91.1 bits (216), Expect = 6e-19
 Identities = 40/50 (80%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   DDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>01_06_1455 +
           37504175-37504231,37504357-37504750,37504865-37505478,
           37506021-37506086
          Length = 376

 Score =  184 bits (449), Expect = 4e-47
 Identities = 92/124 (74%), Positives = 96/124 (77%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPIL 596
           AP+NPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI 
Sbjct: 109 APMNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPIY 167

Query: 597 RKGF 608
            +GF
Sbjct: 168 -EGF 170



 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 41/53 (77%), Positives = 47/53 (88%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           M +E++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 1   MAEEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 53


>03_06_0585 -
           34912159-34912224,34912634-34913247,34913350-34913734,
           34913824-34913883
          Length = 374

 Score =  184 bits (448), Expect = 5e-47
 Identities = 83/91 (91%), Positives = 85/91 (93%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           APLNPKANREKMTQIMFETFN PAMYVAIQA
Sbjct: 110 APLNPKANREKMTQIMFETFNAPAMYVAIQA 140



 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>10_08_0597 +
           19089616-19089675,19089789-19090182,19090451-19091064,
           19091160-19091225
          Length = 377

 Score =  183 bits (446), Expect = 9e-47
 Identities = 89/119 (74%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETF+ PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFSVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>12_01_0409 -
           3230853-3230918,3231372-3231994,3232454-3232847,
           3233000-3233059
          Length = 380

 Score =  182 bits (444), Expect = 2e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPALLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFE+FN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFESFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 54


>05_04_0450 -
           21356877-21356942,21357482-21358095,21358173-21358566,
           21358648-21358704
          Length = 376

 Score =  182 bits (444), Expect = 2e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQ+KRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPE+HPVLLTE
Sbjct: 49  GQKDAYVGDEAQAKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEDHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 42/53 (79%), Positives = 47/53 (88%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           M DE++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 1   MADEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 53


>08_02_0441 -
           17196352-17196536,17196780-17196906,17198018-17198101,
           17198282-17198348,17198575-17198633,17199211-17199336,
           17199406-17199474,17199545-17199653,17199692-17199760,
           17199876-17199979,17200518-17200567,17200696-17200774,
           17200867-17200938,17201083-17201217,17201311-17201421,
           17202088-17202129
          Length = 495

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 49/122 (40%), Positives = 70/122 (57%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           ++VG      R  L + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLN
Sbjct: 53  IVVGAACADLRHQLDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLN 112

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKGF 608
           P  NREKM + MFE +N   +++ +QA        +       SGD G+ H  P++  GF
Sbjct: 113 PVKNREKMIETMFEKYNFAGVFIQVQAVLSLYAQGLLTGLVIDSGD-GVTHVVPVV-DGF 170

Query: 609 RH 614
            +
Sbjct: 171 SY 172



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>08_01_0194 -
           1603702-1603782,1603970-1604062,1604203-1604328,
           1604403-1604513,1604989-1605108,1605665-1605757,
           1606024-1606157,1606503-1606530,1606821-1607075,
           1607167-1607401,1608147-1608193
          Length = 440

 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 41/88 (46%), Positives = 58/88 (65%), Gaps = 3/88 (3%)
 Frame = +3

Query: 255 VGDEAQS---KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 425
           +GDEA S     G+ T K+PI HG V +WD ME+ W    +N LR  PEEH  LLT++P+
Sbjct: 70  IGDEALSLFKSSGLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYFLLTDSPV 129

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQA 509
           +   +RE   +IMFETFN P +Y+++Q+
Sbjct: 130 STPESRECAGEIMFETFNVPGLYISVQS 157



 Score = 34.3 bits (75), Expect = 0.078
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           A+V+DNG+G  K GF+G+  P    P++V
Sbjct: 8   AVVIDNGTGYSKLGFSGNSEPCFTIPTVV 36


>02_04_0473 +
           23197294-23197340,23197443-23197680,23197792-23198016,
           23198616-23198762,23198827-23198961,23199415-23199507,
           23199925-23200044,23200303-23200413,23200486-23200611,
           23200731-23200829,23201024-23201104
          Length = 473

 Score = 88.6 bits (210), Expect = 3e-18
 Identities = 38/71 (53%), Positives = 46/71 (64%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 473
           L YPI +G V NWD ME+ W    +N LR  PE+H  LLTE+PL P   RE   +IMFET
Sbjct: 87  LSYPIHNGQVENWDTMERFWQQCIFNYLRCDPEDHYFLLTESPLTPPETREYTGEIMFET 146

Query: 474 FNTPAMYVAIQ 506
           FN P +Y+A Q
Sbjct: 147 FNVPGLYIACQ 157



 Score = 34.7 bits (76), Expect = 0.059
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           A+V+DNG+G  K GFAG+  P  + P++V
Sbjct: 8   AVVIDNGTGYTKMGFAGNVEPCFITPTVV 36


>08_01_0254 +
           2078380-2078392,2078487-2078578,2079579-2079698,
           2079924-2080097,2080184-2080257,2080847-2080927,
           2081306-2081366,2081437-2081486,2082278-2082332,
           2082599-2082676,2082757-2082810,2083703-2083756,
           2083846-2083906,2084229-2084280,2085118-2085184,
           2085393-2085452,2085546-2085608,2085752-2085814,
           2086337-2086401,2086620-2086688,2086742-2086847
          Length = 503

 Score = 80.6 bits (190), Expect = 9e-16
 Identities = 37/101 (36%), Positives = 56/101 (55%)
 Frame = +3

Query: 207 APPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA 386
           A P   D       L VG E + +R  + +  P++ G VT+WD ++ IW+H F   L + 
Sbjct: 105 AKPMDVDKAKTKRKLYVGQELEFRRDHMEVISPMKDGTVTDWDIVDNIWNHAFRQRLLIN 164

Query: 387 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           PEEHP+L+ E   N    REK  ++MFE +  PA+++A  A
Sbjct: 165 PEEHPMLIAEPSTNTGQQREKAAELMFEKYKVPALFLAKNA 205



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 198
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36


>04_03_0738 +
           19169764-19169897,19169987-19170116,19170614-19170687,
           19171208-19171288,19172054-19172087
          Length = 150

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 449
           P++ G   +WD ++ IW+H F   L + PEEHP+L+ E   N    REK
Sbjct: 92  PMKDGTFIDWDIVDNIWNHAFRQRLLINPEEHPMLIVEPSTNTGQQREK 140


>01_01_1170 -
           9318332-9318461,9318551-9318613,9318694-9318744,
           9318837-9318921,9319005-9319068,9319139-9319340,
           9319808-9320502
          Length = 429

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 3/91 (3%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGI---LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL 407
           G++  LV D+ Q++      +TL+ PI+ G + N +   ++W     N L+V P    +L
Sbjct: 40  GSKKWLVADQLQAQDVDVTGMTLRRPIDRGYLINQEVQREVWERVIRNLLQVDPNNSSLL 99

Query: 408 LTEAPLNPKANREKMTQIMFETFNTPAMYVA 500
           L E   NP A +    +++FE     ++ VA
Sbjct: 100 LVEPQFNPPALQHATDELVFEELGFKSLCVA 130



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V+DNG G+ KAGF GD  P AV P+ + +P
Sbjct: 8   VVLDNGGGLLKAGFGGDMNPTAVVPNCMAKP 38


>01_01_0292 -
           2387653-2387711,2388061-2388684,2388814-2389104,
           2389338-2389390,2390496-2390968,2391090-2391432,
           2391793-2391911,2392081-2392512,2392657-2392747,
           2392833-2392942,2393681-2393875,2394581-2394622,
           2395144-2395268,2395856-2395926,2396047-2396147
          Length = 1042

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/66 (28%), Positives = 37/66 (56%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 473
           ++ P +  +V  ++ ME I    F      +   HP+L+TE   NP  +R +M++++FET
Sbjct: 82  IRSPFDDDVVYQFEYMEYILDFGFDRLGATSEVGHPILMTECECNPSFSRARMSELLFET 141

Query: 474 FNTPAM 491
           +  P++
Sbjct: 142 YGVPSI 147



 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
           +V+DNG+   + G+AG+  PR  F +IV RPRH+
Sbjct: 22  IVIDNGASTFRIGWAGEAEPRVAFRNIVQRPRHR 55


>07_03_0401 +
           17724103-17724463,17724554-17724683,17725068-17725083,
           17725130-17725203,17725693-17725761,17726224-17726257
          Length = 227

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +3

Query: 273 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 449
           ++R  + +  P++ G   +WD ++ IW+H F       PEEHP+L+ E   N    REK
Sbjct: 163 NRRDHMEVISPMKDGTFIDWDIVDNIWNHAF----SFYPEEHPMLIVEPSTNTGQQREK 217


>07_03_0143 -
           14315097-14315130,14315594-14315662,14316152-14316225,
           14316316-14316331,14316716-14316845,14316936-14316999
          Length = 128

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = +3

Query: 273 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 449
           ++R  + +  P++ G   +WD ++ IW+H F        EEHP+L+ E   N    REK
Sbjct: 64  NRRDHMEVISPMKDGTFIDWDIVDNIWNHAF----SFYAEEHPMLIVEPSTNTGQQREK 118


>03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093
          Length = 435

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -1

Query: 316 PCSMGYLRVRIPLLLCASSPTKSPSVPYRPSRPDGGAFPR 197
           PCS  +      L+LC +S ++ P+V +RP+ PDGGA P+
Sbjct: 192 PCSRSH-----DLILC-NSQSRCPTVQHRPTPPDGGAPPK 225


>09_04_0660 -
           19286653-19287271,19287791-19287916,19288016-19288221,
           19288417-19288549,19288632-19288713,19288906-19289035,
           19289187-19289279,19289391-19289510,19289594-19289660,
           19290079-19290137,19290719-19290943
          Length = 619

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%)
 Frame = -2

Query: 603 PFVKWGTGVEDPRRRKSSTIPVVRPDAYSE--STLGWR 496
           PFV+WG     P R  + T+   R     E   T+GWR
Sbjct: 204 PFVEWGMKWSPPTRTAAGTVTFDRESLCGEPARTVGWR 241


>03_01_0470 +
           3619417-3619572,3619681-3619759,3620017-3620258,
           3620804-3621148,3623592-3624116
          Length = 448

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = -3

Query: 215 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 96
           WR  P +  + ARG S P + AL   +P++     +++ H
Sbjct: 251 WRRTPWVGAHAARGGSRPLRRALQGLDPVTIAAIFSTAEH 290


>02_05_0713 + 31159574-31160764
          Length = 396

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 13/46 (28%), Positives = 23/46 (50%)
 Frame = -1

Query: 574 RPPSPEVQHDTGGTTGRVQREHAWMATYMAGVLNVSNMIWVIFSLL 437
           RPP P    D GG  GR+     ++   +A +  +S ++ ++  LL
Sbjct: 38  RPPPPPPTADGGGNGGRISPAVLFIIVILAVIFFISGLLHLLVRLL 83


>02_01_0288 + 1932171-1932188,1932264-1933280
          Length = 344

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = -1

Query: 613 WRNPFRKMGHGCGRPPSPEVQHDTGGTTG 527
           WR P  ++G G  R PSP+ +   GG  G
Sbjct: 264 WRVPAHQLGVGAVRNPSPDGEDFAGGAHG 292


>03_06_0331 -
           33181757-33181795,33182325-33182453,33182941-33182967,
           33183459-33183545,33183827-33183975,33185467-33185521,
           33185596-33187584,33188705-33188782
          Length = 850

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +2

Query: 422 PQPQGQQREDDPDHVRNIQH 481
           P    Q+  DDPDHV+N+ H
Sbjct: 393 PHETNQEDLDDPDHVKNLLH 412


>02_04_0179 +
           20682852-20684510,20684593-20684661,20684741-20684809,
           20686779-20688206
          Length = 1074

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 15/33 (45%), Positives = 17/33 (51%)
 Frame = -1

Query: 256 TKSPSVPYRPSRPDGGAFPRSRGTRREEHHLLR 158
           +K P  P  P  PD  A  RSR TRR    +LR
Sbjct: 216 SKLPPPPAPPPAPDDDAASRSRSTRRRLVKVLR 248


>08_01_1006 -
           10191817-10191822,10192449-10192745,10192826-10192975,
           10194558-10195370
          Length = 421

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -3

Query: 242 CPIPTITP*WRGLPTIEGNTARGASSPAK 156
           C +P   P +RG P++   T RG + PA+
Sbjct: 142 CDMPLAPPGFRGFPSLVSLTLRGVTLPAE 170


>03_06_0192 +
           32230953-32231030,32231130-32231485,32232250-32232425,
           32233857-32234038,32234260-32234443,32235192-32235259,
           32235343-32235495
          Length = 398

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFA-GDDAPRAVFPS 195
           A+VVD GS + KAG A  D +P  V PS
Sbjct: 3   AVVVDAGSKLLKAGIALPDQSPSLVMPS 30



 Score = 27.9 bits (59), Expect = 6.8
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +3

Query: 432 KANREKMTQIMFETFNTPAMYVAIQA 509
           +A RE++ Q+MFE FN    Y + QA
Sbjct: 156 QALREQLAQLMFEKFNVSGFYDSEQA 181


>03_06_0030 + 31161821-31161927,31163700-31163934,31164064-31164826,
            31165816-31167650,31169294-31169424,31169993-31170075,
            31170426-31170680,31171125-31171220,31171695-31171775,
            31171811-31171968,31172434-31172534,31172614-31172629,
            31173390-31173439,31174558-31174588,31175156-31175305,
            31176135-31176173,31176288-31176410,31176496-31176552,
            31176837-31176911,31177003-31177107
          Length = 1496

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 4/33 (12%)
 Frame = -1

Query: 226  SRPDGGA---FPRSRGTRREEHHL-LRNRPCTY 140
            S+ D GA   +P+  GT R+  H+ ++NRPC +
Sbjct: 1333 SKADAGASKTYPQQAGTIRKNGHIVIKNRPCKW 1365


>02_02_0572 + 11667455-11670783,11672026-11672419
          Length = 1240

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 14/31 (45%), Positives = 16/31 (51%)
 Frame = +2

Query: 386 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ 478
           P     PA  GS  P G  R DDPD  RN++
Sbjct: 95  PSSASQPAAGGSKFP-GLSRPDDPDRARNLR 124


>01_06_0946 + 33220910-33222221,33223373-33223734,33223863-33224073,
            33224174-33224411,33224492-33224642,33224733-33224997,
            33231775-33231820,33232167-33232815,33232883-33233384,
            33235023-33235360,33235466-33235676,33235769-33235992,
            33236042-33236115,33236147-33236234,33236316-33236612
          Length = 1655

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 15/28 (53%), Positives = 18/28 (64%)
 Frame = -3

Query: 584  RVWKTPVAGSPARYRWYDRTRTARARLD 501
            RV K+P A SPAR +W+D  R A   LD
Sbjct: 1300 RVRKSP-ALSPARDQWFDENRGAEDDLD 1326


>01_06_0027 - 25742122-25742310,25742481-25742553,25743219-25744159
          Length = 400

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%)
 Frame = -1

Query: 262 SPTKSPSVPYRPSRPDGGAFPRSR-GTRREEHH 167
           +P  SPS P  P  P    FP S   T REE+H
Sbjct: 32  TPQASPSPPPAPDPPTPLLFPESAPSTPREEYH 64


>12_02_0800 +
           23299674-23299678,23299714-23299791,23299876-23299920,
           23300052-23300415,23300493-23300574,23300793-23300873,
           23300974-23302106,23302202-23302350,23302426-23302516,
           23303628-23305940
          Length = 1446

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = -1

Query: 250 SPSVPYRPSRPDGGAFP 200
           +P  PYRP  P GG FP
Sbjct: 294 APGGPYRPLGPPGGGFP 310


>12_01_0843 + 7891622-7892524
          Length = 300

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAV 186
           E+V ++  D GSG  +AG  GD AP  V
Sbjct: 170 EDVTSVWRDGGSGAARAGDDGDGAPAFV 197


>10_07_0100 + 12861588-12862601
          Length = 337

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 14/42 (33%), Positives = 18/42 (42%)
 Frame = +3

Query: 207 APPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNW 332
           AP  GRDG YG E  + G      R  +  + P  H    +W
Sbjct: 292 APAGGRDGSYGDELPVYGTTGVGIRRDIGRRRPYGHAPCRSW 333


>08_01_0855 + 8407411-8407628,8408231-8408267
          Length = 84

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = -2

Query: 456 GSSSLCWPWG*GEPQ*AGLGVPRGRHA 376
           GS+   W W    P  AG+GV RGR A
Sbjct: 20  GSNRWWWWWWWSSPAAAGIGVGRGRAA 46


>07_03_0207 -
           15183894-15184685,15184993-15185078,15186042-15186144,
           15186890-15186971,15187112-15187203,15187295-15187383,
           15187467-15187547,15188610-15188724,15188894-15188935
          Length = 493

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = -3

Query: 407 QDWVFLGGDTQLIVEGMMPNLLHVIPV 327
           Q W+   G T L+V  M P+L++V+ V
Sbjct: 13  QQWIDKEGKTPLMVASMRPDLINVVQV 39


>03_05_0943 + 29034398-29034512,29035059-29035508,29035654-29035826
          Length = 245

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 2/45 (4%)
 Frame = +1

Query: 469 KHSTRPPCTSPSKRALAVRVRSYHRY--RAGLPATGVFHTRAPFY 597
           K +TRPP T+ S  A+A  +  Y R    AGL A G  H     Y
Sbjct: 138 KTATRPPATNGSGMAMASLLDKYRRECGAAGLFAIGRHHNSKEDY 182


>02_05_0477 - 29339649-29340253,29340880-29341492
          Length = 405

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           + VAALV  N  G+ +    G+DA  A  PS++
Sbjct: 44  DAVAALVASNEDGVVEGEGEGEDAAEAPAPSVL 76


>02_01_0370 +
           2659704-2660012,2660318-2660488,2660981-2661058,
           2661658-2661803,2662001-2662112,2662280-2662405,
           2662618-2662731
          Length = 351

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = -1

Query: 283 PLLLCASSPTKSPSVPYRPSRPDGGAFPR 197
           P +  A+SP+ S S+  R + PD  AFP+
Sbjct: 13  PAIAGAASPSPSRSLSRRRAPPDAAAFPK 41


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,943,346
Number of Sequences: 37544
Number of extensions: 532698
Number of successful extensions: 1997
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 1878
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1985
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1478421500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).