SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0036
         (602 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_0011 + 12370624-12370684,12372573-12372718,12372793-123731...    30   1.2  
05_01_0389 + 3039793-3040194                                           30   1.2  
03_01_0027 - 250837-250877,250972-252909,253733-253805,254476-25...    30   1.2  
03_01_0499 - 3766713-3767159,3767742-3767813,3768004-3768657           30   1.6  
12_02_1058 - 25735902-25736000,25736085-25736152,25736575-257366...    29   2.8  
12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894...    29   2.8  
07_01_1173 + 11092482-11093465,11093552-11093914                       29   2.8  
01_06_0666 + 31040768-31041079,31041716-31041889,31041996-31042646     29   2.8  
08_01_0649 + 5607234-5608397,5609358-5609513,5609598-5609796,561...    29   3.7  
05_04_0396 - 20934444-20934969,20935042-20935316,20935447-20935581     29   3.7  
05_02_0155 + 7146999-7147276,7147447-7147492,7148153-7148284           29   3.7  
12_01_0727 + 6446283-6449300                                           28   5.0  
04_04_1249 - 32067644-32067787,32068245-32068346,32068415-320684...    28   5.0  
04_04_0922 - 29439313-29439718,29439842-29440053                       28   5.0  
02_01_0566 - 4144104-4144230,4144492-4144649,4145770-4146885           28   5.0  
10_08_0397 + 17571492-17571664,17571875-17572034,17572140-175722...    28   6.5  
05_05_0006 + 21450739-21451434                                         28   6.5  
05_01_0463 - 3666626-3666933,3667060-3667258,3667388-3667629,366...    28   6.5  
11_04_0098 - 13459424-13459704,13459954-13460074                       27   8.7  
10_07_0016 + 11826066-11826773                                         27   8.7  
07_03_0476 - 18547223-18548187,18548743-18549958                       27   8.7  
06_03_0499 + 21461608-21463427,21463517-21463627,21463867-214641...    27   8.7  
05_03_0002 - 7278527-7279675,7279768-7280325,7280433-7280594           27   8.7  
03_04_0018 - 16484109-16484300,16484575-16484656,16484746-164848...    27   8.7  
03_01_0065 + 529200-529438,529770-529929,530217-530299,530398-53...    27   8.7  
02_03_0212 - 16460665-16460766,16460971-16461298,16461379-164615...    27   8.7  
02_01_0432 - 3144560-3144655,3144792-3144832,3145019-3145094,314...    27   8.7  
01_01_0568 - 4207812-4209587,4210056-4210291,4210647-4210793,421...    27   8.7  

>07_03_0011 +
           12370624-12370684,12372573-12372718,12372793-12373129,
           12374323-12374452,12375346-12375406,12375572-12375618,
           12376873-12376950,12377195-12377345,12377495-12377558,
           12377735-12377893,12378007-12378128,12378952-12378981,
           12379050-12379124,12379563-12379644,12379809-12379938,
           12381417-12382164,12382833-12383054,12383127-12383276,
           12384851-12384904,12384985-12385058,12386130-12386204,
           12386365-12386584
          Length = 1071

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = +2

Query: 398 PVRSSDVSAPCHSGWSDPSTSRRW 469
           P  S  V  PC SGWS  ST+R W
Sbjct: 273 PNVSKRVQFPCMSGWSGDSTARIW 296


>05_01_0389 + 3039793-3040194
          Length = 133

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = +2

Query: 365 SRRREACWPAAPVRSSDVSAPCHSGWSDPSTSRRWRT 475
           SRRR   W     R++ ++     GW+ P T R WR+
Sbjct: 19  SRRRAVRWMKGVRRAARLTGGGDDGWAAPPTRRLWRS 55


>03_01_0027 -
           250837-250877,250972-252909,253733-253805,254476-254555,
           255336-255595,255721-255785,256747-256839
          Length = 849

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 17/57 (29%), Positives = 28/57 (49%)
 Frame = -3

Query: 261 VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHAL 91
           + +L   K     QQQQ    + D+EL LS+ + +L + +    L  ++  QKK  L
Sbjct: 784 ILDLNSEKDAVLLQQQQSLAKISDLELQLSKTQLELKNSEQKMQLLELEITQKKTCL 840


>03_01_0499 - 3766713-3767159,3767742-3767813,3768004-3768657
          Length = 390

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 20/67 (29%), Positives = 32/67 (47%)
 Frame = -1

Query: 410 NFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RETSCR 231
           N  ++LQA + R   ++ + +RLLE   F+ P+I +           L+  +   E SC 
Sbjct: 210 NHNKKLQAEERRSMWVSVLAERLLESVPFSPPRIVALKGREAA--SELINLNKETEASCS 267

Query: 230 KRLNNSS 210
            R  NSS
Sbjct: 268 NRSENSS 274


>12_02_1058 -
           25735902-25736000,25736085-25736152,25736575-25736638,
           25736838-25736919,25737503-25737561,25737664-25737723,
           25737884-25738046,25738236-25738360,25738827-25738859,
           25739098-25739160,25739364-25739423,25739972-25740196,
           25740272-25740433
          Length = 420

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +1

Query: 49  GVDAFGVRAHVGLQQRVLLLEILHA-GQILPVVLAEQLSFNFREPKFNVLD 198
           GV +FG+ A         + E  +A  +  PVV AE L  N ++P   VLD
Sbjct: 82  GVGSFGIAARCNATSSSAVSEATNALPRTEPVVSAEWLHANLKDPDVKVLD 132


>12_02_1036 -
           25587313-25587890,25589209-25589272,25589356-25589448,
           25589533-25589683,25590474-25590539,25590594-25590907
          Length = 421

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 19/67 (28%), Positives = 28/67 (41%), Gaps = 6/67 (8%)
 Frame = +2

Query: 203 RLYCCC*AA------SCNLFPFSSKTAPVAPIFRPALPRETIFEVEQNVRAQADACRRPL 364
           +LYC C A+      SC   P  +K+    P   PALP + +  +E    +     R P+
Sbjct: 126 KLYCVCFASGSHCSESCGCDPCYNKSIHGVPRSTPALPLKAVQTLETGQDSVEQLIRSPM 185

Query: 365 SRRREAC 385
              R  C
Sbjct: 186 DFGRRKC 192


>07_01_1173 + 11092482-11093465,11093552-11093914
          Length = 448

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +2

Query: 362 LSRRREACWPAAPVRSSDVSAPCHSGWSDPSTS 460
           LSRR  + WP+AP+R  D   P  S +   + S
Sbjct: 48  LSRRWRSLWPSAPLRLHDSDLPSRSQYLSAAIS 80


>01_06_0666 + 31040768-31041079,31041716-31041889,31041996-31042646
          Length = 378

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 17/45 (37%), Positives = 23/45 (51%)
 Frame = +2

Query: 332 RAQADACRRPLSRRREACWPAAPVRSSDVSAPCHSGWSDPSTSRR 466
           R+  D+ RRP S    A   A  V  S+V  PCH G  + + +RR
Sbjct: 46  RSGVDSGRRP-SEAALAAVAAVAVEPSEVRRPCHCGEVENAIARR 89


>08_01_0649 +
           5607234-5608397,5609358-5609513,5609598-5609796,
           5612419-5613608,5614505-5614660,5614742-5615041
          Length = 1054

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = +2

Query: 290 ALPRETIFEVEQNVRAQADACRRPLSRRREACWPAAPVRSSDVSAPC 430
           ALP   +F +  +++A+       LSRR    W +AP    DV  PC
Sbjct: 532 ALPDAVLFRIVSHLKAREAVRTSGLSRRWRHVWASAP--RVDVRYPC 576


>05_04_0396 - 20934444-20934969,20935042-20935316,20935447-20935581
          Length = 311

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 1/41 (2%)
 Frame = +2

Query: 356 RPLSRRRE-ACWPAAPVRSSDVSAPCHSGWSDPSTSRRWRT 475
           RPL R    A  PAA   SS V+ P    W D +  R  RT
Sbjct: 23  RPLGRGAALALAPAARTSSSSVTGPRRGSWEDVARRRSGRT 63


>05_02_0155 + 7146999-7147276,7147447-7147492,7148153-7148284
          Length = 151

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 22/69 (31%), Positives = 31/69 (44%)
 Frame = -3

Query: 450 GSDQPEWQGAETSELRTGAAGQQASRRRDNGRRQASA*ARTFCSTSNIVSRGRAGRNMGA 271
           G +  E   A  S  R+GA  ++A  RR  GRR+++       +TS     G  GR  G 
Sbjct: 33  GIEGKERSAAHLSHARSGAKQKRARARRRAGRRRSTGAGEGSATTSG----GGIGRADGN 88

Query: 270 TGAVFELKG 244
              V+  KG
Sbjct: 89  ERLVWRSKG 97


>12_01_0727 + 6446283-6449300
          Length = 1005

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = -2

Query: 310 YRLAWKSWAEYGSDWCSLRAEGKQVAGSGSTTAVQPGRRG 191
           Y  A++SWA  G+D CS   EG +  G G         RG
Sbjct: 52  YSAAFRSWAAAGTDCCSW--EGVRCGGGGDGRVTSLDLRG 89


>04_04_1249 -
           32067644-32067787,32068245-32068346,32068415-32068438,
           32068439-32068543,32068625-32068729,32068885-32068966,
           32069254-32069456,32069534-32069692,32070045-32070154,
           32070264-32070405,32070544-32070690,32070773-32070847,
           32070923-32071132,32071223-32071426,32071514-32071633,
           32071743-32071852,32072033-32072177,32072266-32072499,
           32072611-32072646
          Length = 818

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
 Frame = -3

Query: 222 QQQQYNRAVEDIELWLSEVE-GQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDA 49
           Q  +Y + +     W  E+E G L+ ++  +     +N Q  HA LEA +SS  E + A
Sbjct: 95  QMSEYIKKLRACIRWYIELEDGYLVEQEKLRSTMDAENAQ--HAKLEAQLSSDLEELKA 151


>04_04_0922 - 29439313-29439718,29439842-29440053
          Length = 205

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 17/65 (26%), Positives = 31/65 (47%)
 Frame = -2

Query: 262 SLRAEGKQVAGSGSTTAVQPGRRGH*TLALGS*RTAAQRGLREGSDQRAESPEEARAVGG 83
           S  +EG ++A   S++       GH  ++        +RGL +  D +++S     AVGG
Sbjct: 34  SSSSEGMELADDASSSGSSSSAAGHFEMSSLMTELPLKRGLSKFFDGKSQSFASLAAVGG 93

Query: 82  RRELA 68
             ++A
Sbjct: 94  LEDMA 98


>02_01_0566 - 4144104-4144230,4144492-4144649,4145770-4146885
          Length = 466

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +2

Query: 8   GSLFYELARPGSRMASMRSACELTSASNSACFFWR 112
           GSLFY++ +    +A  RS   LT A   A + W+
Sbjct: 392 GSLFYDMKQKEMELAERRSKGFLTKAETQAKYGWQ 426


>10_08_0397 +
           17571492-17571664,17571875-17572034,17572140-17572222,
           17572333-17572468,17572515-17572610,17573105-17573218,
           17573322-17573405,17573493-17573648,17573744-17573818,
           17574318-17574424,17574508-17574688,17574832-17575020,
           17575397-17575477,17575621-17575755,17576007-17576329,
           17576503-17576608,17576734-17576883,17577034-17577180
          Length = 831

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 21/81 (25%), Positives = 33/81 (40%), Gaps = 5/81 (6%)
 Frame = -1

Query: 368 EITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RETSCRKRLNN-----SSTT 204
           ++TA+ K L+E     Q Q+S  V E   + ++L   S   +TSC   +          +
Sbjct: 76  KLTAMNKLLMEENERLQKQVSQLVHENAYMKQQLQNPSLGNDTSCESNVTTPQNPLRDAS 135

Query: 203 GPSRTLNFGSRKLKDSCSART 141
            PS  L      L +  S  T
Sbjct: 136 NPSGLLTIAEETLTEFLSKAT 156


>05_05_0006 + 21450739-21451434
          Length = 231

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 15/38 (39%), Positives = 17/38 (44%)
 Frame = +2

Query: 275 PIFRPALPRETIFEVEQNVRAQADACRRPLSRRREACW 388
           P    A    T++EVE  VR Q     R   RRR A W
Sbjct: 105 PATYAATNTHTLYEVEDEVRRQRRKDMRRRRRRRAAAW 142


>05_01_0463 -
           3666626-3666933,3667060-3667258,3667388-3667629,
           3667823-3669035
          Length = 653

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = -1

Query: 464 DDSYLDPTNLNG--KVQKHQNF-EQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVE 294
           D+  LD  NL+   ++ K   +  QE ++N+P + E+  + + LLELE    P++   + 
Sbjct: 588 DNKLLDDVNLDEAERISKVACWCVQENESNRPTMGEVVQILEGLLELEMPPMPRLLQAIT 647

Query: 293 ELG 285
             G
Sbjct: 648 ATG 650


>11_04_0098 - 13459424-13459704,13459954-13460074
          Length = 133

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 12/26 (46%), Positives = 14/26 (53%)
 Frame = +2

Query: 362 LSRRREACWPAAPVRSSDVSAPCHSG 439
           + RRR  CW A+P R S   A  H G
Sbjct: 19  IGRRRAECWAASPPRRSTSWACGHDG 44


>10_07_0016 + 11826066-11826773
          Length = 235

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 17/39 (43%), Positives = 19/39 (48%)
 Frame = -2

Query: 184 TLALGS*RTAAQRGLREGSDQRAESPEEARAVGGRRELA 68
           T A G+ R AA R      D+ A   EEA A GGR   A
Sbjct: 61  TAACGAGRWAAARDEAAAQDEAAARDEEAGADGGRLHAA 99


>07_03_0476 - 18547223-18548187,18548743-18549958
          Length = 726

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = -1

Query: 224 LNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI*PACRISR 105
           ++N+++TGPS T   G    +  C AR   +I P CR  R
Sbjct: 322 VSNNASTGPSGTPRPGPPPTRTGCQARMVIKITP-CRTYR 360


>06_03_0499 +
           21461608-21463427,21463517-21463627,21463867-21464143,
           21464265-21464353,21464508-21464595,21464698-21464907,
           21464985-21465110,21465429-21465620,21466532-21467188
          Length = 1189

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 14/49 (28%), Positives = 24/49 (48%)
 Frame = -3

Query: 213 QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH 67
           ++N   + + + L + +GQ+L    G D      L K   ++EAD S H
Sbjct: 616 EFNSKRKRMSVILKDEDGQILLFCKGADSIIFDRLAKNGRMIEADTSKH 664


>05_03_0002 - 7278527-7279675,7279768-7280325,7280433-7280594
          Length = 622

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 21/46 (45%), Positives = 25/46 (54%), Gaps = 2/46 (4%)
 Frame = +3

Query: 171 PRAK--VQCPRRPGCTAVVEPLPATCFPSARRLHQSLPYSAQLFHA 302
           PRA   V+ PRR G  AVV PL +  F S + +  SLP S   F A
Sbjct: 53  PRAPSLVRVPRRGG-EAVVPPLESPGFRSVQPVSVSLPASPSGFGA 97


>03_04_0018 -
           16484109-16484300,16484575-16484656,16484746-16484856,
           16484937-16485188,16485274-16485677,16486035-16486952,
           16486990-16487475,16487566-16487763
          Length = 880

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 3/30 (10%)
 Frame = +2

Query: 395 APVRSSDVSAPCHSGWS---DPSTSRRWRT 475
           AP+ S +V+AP  SG +   D ST   WRT
Sbjct: 10  APIASQEVNAPQKSGSNKQPDASTEETWRT 39


>03_01_0065 +
           529200-529438,529770-529929,530217-530299,530398-530488,
           530585-530680,531107-531220,531325-531408,531493-531648,
           531755-531829,532172-532278,532361-532544,532970-533158,
           533372-533452,533794-533925,534302-534355,534484-534809,
           534925-535030,535491-535640,535763-535909
          Length = 857

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 20/81 (24%), Positives = 34/81 (41%), Gaps = 5/81 (6%)
 Frame = -1

Query: 368 EITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RETSCRKRLNN-----SSTT 204
           ++TA+ K L+E     Q Q+S  V E   + ++L  +    +TSC   +          +
Sbjct: 98  KLTAMNKLLMEENERLQKQVSQLVHENAHMRQQLQNTPLANDTSCESNVTTPQNPLRDAS 157

Query: 203 GPSRTLNFGSRKLKDSCSART 141
            PS  L+     L +  S  T
Sbjct: 158 NPSGLLSIAEETLTEFLSKAT 178


>02_03_0212 -
           16460665-16460766,16460971-16461298,16461379-16461502,
           16461576-16461825,16462185-16462265,16463030-16463114,
           16463200-16463321,16463865-16464672,16464775-16465027,
           16465998-16466796
          Length = 983

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 17/43 (39%), Positives = 20/43 (46%)
 Frame = +2

Query: 341 ADACRRPLSRRREACWPAAPVRSSDVSAPCHSGWSDPSTSRRW 469
           ADA R P SR+R     AAP R S  + P     +DP     W
Sbjct: 183 ADAFRAPASRQRWGDEAAAPFRESRRTQPALCLVADPCRGVVW 225


>02_01_0432 -
           3144560-3144655,3144792-3144832,3145019-3145094,
           3145465-3145542,3146121-3146208,3146613-3146686,
           3147445-3147579,3147699-3147770,3148239-3148325,
           3148418-3148522,3149028-3149085,3149576-3149634,
           3149960-3150056,3150217-3150317,3150443-3150487,
           3150619-3150681,3151082-3151147,3151286-3151342,
           3151570-3151656,3152063-3152239,3152413-3152625
          Length = 624

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 22/75 (29%), Positives = 34/75 (45%)
 Frame = +3

Query: 132 PSRSPR*AAVLQLPRAKVQCPRRPGCTAVVEPLPATCFPSARRLHQSLPYSAQLFHARRY 311
           PS  PR  A+   PR +V CP  P  +      PA+   + +   Q +P S    + R +
Sbjct: 31  PSAPPRPRALSAAPRGRVVCPAAPASS------PASTTDAGQDRLQKVPVS----NIRNF 80

Query: 312 LRLSKMFELKQTLAD 356
             ++ +   K TLAD
Sbjct: 81  SIIAHIDHGKSTLAD 95


>01_01_0568 -
           4207812-4209587,4210056-4210291,4210647-4210793,
           4211857-4212145
          Length = 815

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 19/63 (30%), Positives = 30/63 (47%)
 Frame = -3

Query: 279 MGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKK 100
           + A+G +  L G   QE    +    ++E  +L  +E    L+ E+Y K L   Q  QKK
Sbjct: 198 VAASGVLAGLYGTSQQEKKALESVVSSMES-KLAENEAAISLMRENYEKRLLDQQTAQKK 256

Query: 99  HAL 91
            A+
Sbjct: 257 QAM 259


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,071,508
Number of Sequences: 37544
Number of extensions: 328709
Number of successful extensions: 1480
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 1426
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1480
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1431112012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).