SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0035
         (392 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323...    99   1e-21
11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306...    99   1e-21
10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910...    99   1e-21
05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32...    99   1e-21
03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731...    99   1e-21
01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782...    99   1e-21
12_02_1282 + 27528159-27529148,27529549-27529614                       98   2e-21
03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137...    98   2e-21
01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054...    98   2e-21
05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585...    97   4e-21
08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207...    48   2e-06
08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981...    44   4e-05
01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931...    38   0.003
08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160...    36   0.009
02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980...    33   0.062
01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238...    32   0.19 
04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182...    30   0.58 
11_04_0151 + 14135390-14135630,14135723-14136132                       29   1.8  
11_04_0150 + 14127378-14127612,14127705-14128144                       29   1.8  
07_01_1123 - 10385215-10385574,10385676-10385810,10386385-103870...    28   2.3  
07_01_1122 - 10359014-10359127,10359686-10359769,10360375-10361331     28   2.3  
12_02_0626 - 21344530-21344986,21346132-21346469,21347300-213473...    28   3.1  
09_01_0066 - 978018-978500,978588-979034,979113-979412,979521-97...    28   3.1  
04_01_0332 + 4378111-4378329,4378862-4378997,4379113-4379165,437...    28   3.1  
02_04_0366 - 22389591-22390527,22391296-22391429,22391762-223918...    28   3.1  
11_06_0545 + 24839536-24843421,24843871-24844310                       27   4.1  
07_03_1449 - 26608547-26608663,26608864-26608912,26609139-26609194     27   4.1  
03_02_0235 + 6644083-6644125,6645218-6645315,6645448-6645498,664...    27   4.1  
04_03_1001 - 21609280-21610131                                         27   5.4  
03_01_0273 - 2107778-2108772,2108857-2109043,2109121-2110575,211...    27   5.4  
12_01_0498 - 3955300-3955317,3955399-3955503,3955600-3955677,395...    27   7.1  
11_01_0419 + 3226224-3226756,3228010-3228169,3228256-3228435,322...    27   7.1  
08_01_0552 - 4842417-4842632,4842878-4843378                           27   7.1  
01_05_0612 - 23652121-23652400,23653031-23654427                       27   7.1  
08_02_1402 - 26786011-26786128,26786263-26786516,26787505-267877...    26   9.4  
08_02_1037 - 23851750-23852132,23852622-23852784                       26   9.4  
05_05_0017 + 21546434-21546841                                         26   9.4  
04_04_0212 + 23646043-23646369,23646457-23647304,23647409-23649158     26   9.4  
02_05_1214 + 34976814-34979813                                         26   9.4  
01_05_0698 + 24376193-24376708                                         26   9.4  

>12_01_0409 -
           3230853-3230918,3231372-3231994,3232454-3232847,
           3233000-3233059
          Length = 380

 Score = 98.7 bits (235), Expect = 1e-21
 Identities = 42/47 (89%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI +NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84



 Score = 60.1 bits (139), Expect = 6e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>11_01_0403 +
           3059650-3059709,3059807-3060200,3060275-3060930,
           3060979-3061044
          Length = 391

 Score = 98.7 bits (235), Expect = 1e-21
 Identities = 42/47 (89%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI +NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84



 Score = 60.1 bits (139), Expect = 6e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>10_08_0597 +
           19089616-19089675,19089789-19090182,19090451-19091064,
           19091160-19091225
          Length = 377

 Score = 98.7 bits (235), Expect = 1e-21
 Identities = 42/47 (89%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI +NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84



 Score = 60.1 bits (139), Expect = 6e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>05_01_0047 -
           323097-323162,323287-323900,324233-324626,324718-324777
          Length = 377

 Score = 98.7 bits (235), Expect = 1e-21
 Identities = 42/47 (89%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI +NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84



 Score = 60.1 bits (139), Expect = 6e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>03_05_0926 +
           28871800-28871859,28871943-28872336,28872586-28873199,
           28873281-28873346
          Length = 377

 Score = 98.7 bits (235), Expect = 1e-21
 Identities = 42/47 (89%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI +NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84



 Score = 60.1 bits (139), Expect = 6e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>01_07_0285 -
           42476767-42476832,42476990-42477603,42477821-42478214,
           42478301-42478360
          Length = 377

 Score = 98.7 bits (235), Expect = 1e-21
 Identities = 42/47 (89%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI +NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDM 84



 Score = 60.1 bits (139), Expect = 6e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>12_02_1282 + 27528159-27529148,27529549-27529614
          Length = 351

 Score = 98.3 bits (234), Expect = 2e-21
 Identities = 42/47 (89%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI  NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDM 84



 Score = 58.8 bits (136), Expect = 1e-09
 Identities = 26/36 (72%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   DDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>03_06_0585 -
           34912159-34912224,34912634-34913247,34913350-34913734,
           34913824-34913883
          Length = 374

 Score = 98.3 bits (234), Expect = 2e-21
 Identities = 42/47 (89%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI  NWDDM
Sbjct: 38  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDM 84



 Score = 60.1 bits (139), Expect = 6e-10
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 40


>01_06_1455 +
           37504175-37504231,37504357-37504750,37504865-37505478,
           37506021-37506086
          Length = 376

 Score = 98.3 bits (234), Expect = 2e-21
 Identities = 42/47 (89%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHGI  NWDDM
Sbjct: 37  GRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDM 83



 Score = 62.1 bits (144), Expect = 2e-10
 Identities = 27/39 (69%), Positives = 32/39 (82%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           M +E++  +V DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MAEEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 39


>05_04_0450 -
           21356877-21356942,21357482-21358095,21358173-21358566,
           21358648-21358704
          Length = 376

 Score = 97.1 bits (231), Expect = 4e-21
 Identities = 41/47 (87%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+YVGDEAQ+KRGILTLKYPIEHGI  NWDDM
Sbjct: 37  GRPRHTGVMVGMGQKDAYVGDEAQAKRGILTLKYPIEHGIVNNWDDM 83



 Score = 63.7 bits (148), Expect = 5e-11
 Identities = 28/39 (71%), Positives = 32/39 (82%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           M DE++  +V DNG+GM KAGFAG DAPRAVFPSIVG P
Sbjct: 1   MADEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRP 39


>08_01_0254 +
           2078380-2078392,2078487-2078578,2079579-2079698,
           2079924-2080097,2080184-2080257,2080847-2080927,
           2081306-2081366,2081437-2081486,2082278-2082332,
           2082599-2082676,2082757-2082810,2083703-2083756,
           2083846-2083906,2084229-2084280,2085118-2085184,
           2085393-2085452,2085546-2085608,2085752-2085814,
           2086337-2086401,2086620-2086688,2086742-2086847
          Length = 503

 Score = 48.4 bits (110), Expect = 2e-06
 Identities = 20/32 (62%), Positives = 27/32 (84%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSI 247
           +EV+A+V+D GS  CKAG+AG D P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36



 Score = 27.1 bits (57), Expect = 5.4
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 301 YVGDEAQSKRGILTLKYPIEHGIATNWD 384
           YVG E + +R  + +  P++ G  T+WD
Sbjct: 120 YVGQELEFRRDHMEVISPMKDGTVTDWD 147


>08_02_0441 -
           17196352-17196536,17196780-17196906,17198018-17198101,
           17198282-17198348,17198575-17198633,17199211-17199336,
           17199406-17199474,17199545-17199653,17199692-17199760,
           17199876-17199979,17200518-17200567,17200696-17200774,
           17200867-17200938,17201083-17201217,17201311-17201421,
           17202088-17202129
          Length = 495

 Score = 44.0 bits (99), Expect = 4e-05
 Identities = 18/34 (52%), Positives = 24/34 (70%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIR 268
           +V DNG+G  K GFAG + P +VFP +VG P +R
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLR 40



 Score = 30.7 bits (66), Expect = 0.44
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = +1

Query: 295 DSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           D  VG      R  L + YP+ +GI  +WDDM
Sbjct: 52  DIVVGAACADLRHQLDVSYPVTNGIVQSWDDM 83


>01_01_1170 -
           9318332-9318461,9318551-9318613,9318694-9318744,
           9318837-9318921,9319005-9319068,9319139-9319340,
           9319808-9320502
          Length = 429

 Score = 37.9 bits (84), Expect = 0.003
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA*WSVWDR 292
           +V+DNG G+ KAGF G   P AV P+ +  P     W V D+
Sbjct: 8   VVLDNGGGLLKAGFGGDMNPTAVVPNCMAKPPGSKKWLVADQ 49


>08_01_0194 -
           1603702-1603782,1603970-1604062,1604203-1604328,
           1604403-1604513,1604989-1605108,1605665-1605757,
           1606024-1606157,1606503-1606530,1606821-1607075,
           1607167-1607401,1608147-1608193
          Length = 440

 Score = 36.3 bits (80), Expect = 0.009
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 3/39 (7%)
 Frame = +1

Query: 283 MGQKDSYVGDEAQS---KRGILTLKYPIEHGIATNWDDM 390
           M   D ++GDEA S     G+ T K+PI HG   +WD M
Sbjct: 63  MADLDFFIGDEALSLFKSSGLYTRKHPINHGQVDDWDTM 101



 Score = 33.1 bits (72), Expect = 0.082
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           A+V+DNG+G  K GF+G   P    P++V
Sbjct: 8   AVVIDNGTGYSKLGFSGNSEPCFTIPTVV 36


>02_04_0473 +
           23197294-23197340,23197443-23197680,23197792-23198016,
           23198616-23198762,23198827-23198961,23199415-23199507,
           23199925-23200044,23200303-23200413,23200486-23200611,
           23200731-23200829,23201024-23201104
          Length = 473

 Score = 33.5 bits (73), Expect = 0.062
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           A+V+DNG+G  K GFAG   P  + P++V
Sbjct: 8   AVVIDNGTGYTKMGFAGNVEPCFITPTVV 36



 Score = 29.1 bits (62), Expect = 1.3
 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 3/39 (7%)
 Frame = +1

Query: 283 MGQKDSYVGDEAQSKR---GILTLKYPIEHGIATNWDDM 390
           M   D ++G++A ++        L YPI +G   NWD M
Sbjct: 64  MADLDFFIGEDALARSRSSNTYNLSYPIHNGQVENWDTM 102


>01_01_0292 -
           2387653-2387711,2388061-2388684,2388814-2389104,
           2389338-2389390,2390496-2390968,2391090-2391432,
           2391793-2391911,2392081-2392512,2392657-2392747,
           2392833-2392942,2393681-2393875,2394581-2394622,
           2395144-2395268,2395856-2395926,2396047-2396147
          Length = 1042

 Score = 31.9 bits (69), Expect = 0.19
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           +V+DNG+   + G+AG   PR  F +IV  P  R+
Sbjct: 22  IVIDNGASTFRIGWAGEAEPRVAFRNIVQRPRHRS 56


>04_04_1515 +
           34117383-34117732,34117833-34117918,34118227-34118297,
           34118457-34118524,34118692-34118753,34119010-34119107,
           34119545-34119626,34119935-34120077,34120233-34120381,
           34120461-34120594,34120714-34120832,34120926-34121014,
           34121398-34121515
          Length = 522

 Score = 30.3 bits (65), Expect = 0.58
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAP 226
           +++VD GSG CK G++ Y AP
Sbjct: 141 SIIVDGGSGYCKYGWSKYAAP 161


>11_04_0151 + 14135390-14135630,14135723-14136132
          Length = 216

 Score = 28.7 bits (61), Expect = 1.8
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +1

Query: 160 CRVGSRQWLRYVQGRLRRI*CSSRSVSLDRGKPRHQ 267
           C  G R   R+  G LR +   +R VS+DR  P H+
Sbjct: 46  CSYGGRILPRHADGALRYVGGDNRVVSVDRSLPFHE 81


>11_04_0150 + 14127378-14127612,14127705-14128144
          Length = 224

 Score = 28.7 bits (61), Expect = 1.8
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +1

Query: 160 CRVGSRQWLRYVQGRLRRI*CSSRSVSLDRGKPRHQ 267
           C  G R   R+  G LR +   +R VS+DR  P H+
Sbjct: 44  CSYGGRILPRHADGALRYVGGDNRVVSVDRSLPFHE 79


>07_01_1123 -
           10385215-10385574,10385676-10385810,10386385-10387091,
           10387158-10387455
          Length = 499

 Score = 28.3 bits (60), Expect = 2.3
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = -3

Query: 321 LCLISYIRVLLSHTDHHALMAGLPTIEGNTARGA 220
           L L+S  +V +S T  H+++AG P +EG   R +
Sbjct: 208 LKLLSLRQVKISETSLHSIIAGCPALEGLLLRNS 241


>07_01_1122 - 10359014-10359127,10359686-10359769,10360375-10361331
          Length = 384

 Score = 28.3 bits (60), Expect = 2.3
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = -3

Query: 321 LCLISYIRVLLSHTDHHALMAGLPTIEGNTARGA 220
           L L+S  +V +S T  H+++AG P +EG   R +
Sbjct: 192 LKLLSLRQVKISETSLHSIIAGCPALEGLLLRNS 225


>12_02_0626 -
           21344530-21344986,21346132-21346469,21347300-21347338,
           21347572-21347629,21349854-21350136,21350404-21350766,
           21350768-21350840
          Length = 536

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 18/61 (29%), Positives = 25/61 (40%)
 Frame = -3

Query: 369 DSVFDGVFEGQDTSFALCLISYIRVLLSHTDHHALMAGLPTIEGNTARGASYPAKPALHI 190
           D   DGV+E  D   A  L+ ++R        + L+  LPT  G   R  +    P   I
Sbjct: 215 DLAEDGVWEVADEVDAFFLVFFLRHRALRNVPNCLLVSLPTQVGTVKRAHNSSCSPMEGI 274

Query: 189 P 187
           P
Sbjct: 275 P 275


>09_01_0066 -
           978018-978500,978588-979034,979113-979412,979521-979855,
           980325-980703
          Length = 647

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = -2

Query: 286 PYRPSRPDGGASHDRGKHCARSIISCEA 203
           P +P+ P  GA+  R + C R ++ C A
Sbjct: 60  PTKPASPPTGAALYRARRCRRKLLRCRA 87


>04_01_0332 +
           4378111-4378329,4378862-4378997,4379113-4379165,
           4379286-4379394,4379467-4379603,4379698-4379894,
           4379979-4380128,4380233-4380293,4380380-4380500,
           4380901-4380991,4381116-4381209,4381446-4381541,
           4382176-4382316,4382592-4382642,4383093-4383161,
           4384072-4384142,4384244-4384336,4384820-4384910,
           4386164-4386235,4387226-4387351,4387537-4387593,
           4387926-4388000,4388570-4388658,4388814-4388891,
           4389308-4389446,4389868-4389977,4390151-4390250,
           4390548-4390655
          Length = 977

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDS--YVGDEAQSKRGILTLKYPIEHGIATNWDD 387
           G P  QG   G+  + +  Y G+EA ++R + T    I+ G+A N  D
Sbjct: 646 GNPLQQGFSTGLFLEPNGYYQGNEADTRRELATYADHIQIGLAGNLKD 693


>02_04_0366 -
           22389591-22390527,22391296-22391429,22391762-22391816,
           22392364-22393225,22393342-22393459,22393647-22393737,
           22394627-22394670
          Length = 746

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 2/57 (3%)
 Frame = -2

Query: 193 HTGAIVYYQRGNFFVAHLELVKLVRCRCDKMKIKRPAVTANREKQIPD--CRPGAGT 29
           HT  + Y  R   +V    L+ +  C C  + +K    T+ RE+   D   RP A T
Sbjct: 361 HTSKVAYTDRLRVYVTRCALLIVQYCCCQPVTVKAEMDTSYREEAEDDNSVRPLANT 417


>11_06_0545 + 24839536-24843421,24843871-24844310
          Length = 1441

 Score = 27.5 bits (58), Expect = 4.1
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = -3

Query: 291  LSHTDHHALMAGLPTIEGN-TARGASYPAKPALHIPEPLSTTNAATSSSHI 142
            ++HTD     A  P+ + N T+RG+S+ +  A+HIP  +    +    SH+
Sbjct: 1018 VAHTD-----APTPSKDDNLTSRGSSHESFTAIHIPRGIKNMTSMQILSHV 1063


>07_03_1449 - 26608547-26608663,26608864-26608912,26609139-26609194
          Length = 73

 Score = 27.5 bits (58), Expect = 4.1
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +3

Query: 231 QCFPRSWEAPPSGRDGRYGTEGLLCRR*GTEQKRY 335
           Q   RSWE    G+DG+ G+    CR   TEQ+ Y
Sbjct: 4   QACRRSWE----GQDGKAGSFQTCCRMKNTEQQDY 34


>03_02_0235 +
           6644083-6644125,6645218-6645315,6645448-6645498,
           6645573-6645686,6645771-6645971,6646047-6646148,
           6647245-6647352,6647745-6647995,6648108-6648279,
           6648341-6648397,6648555-6648710,6648807-6648857,
           6649053-6649193,6649270-6649464,6649534-6649665,
           6649768-6649941,6650396-6650635,6650761-6650955
          Length = 826

 Score = 27.5 bits (58), Expect = 4.1
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = -2

Query: 70  REKQIPDCRPGAGTPAPGILPA 5
           +EK+ P  +P AG PAP  +PA
Sbjct: 537 QEKKAPGKKPPAGAPAPAPVPA 558


>04_03_1001 - 21609280-21610131
          Length = 283

 Score = 27.1 bits (57), Expect = 5.4
 Identities = 18/69 (26%), Positives = 26/69 (37%)
 Frame = -2

Query: 289 VPYRPSRPDGGASHDRGKHCARSIISCEAGLAHTGAIVYYQRGNFFVAHLELVKLVRCRC 110
           VPY      GG    + K C R+  +   G A  G       G +  A  + +K   C C
Sbjct: 7   VPYEGGSAGGGGGGGKYKECMRNHAAAMGGQAFDGC------GEYMPASPDSLKCAACGC 60

Query: 109 DKMKIKRPA 83
            +   +R A
Sbjct: 61  HRSFHRRAA 69


>03_01_0273 -
           2107778-2108772,2108857-2109043,2109121-2110575,
           2110670-2111251
          Length = 1072

 Score = 27.1 bits (57), Expect = 5.4
 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 5/53 (9%)
 Frame = +3

Query: 9   GRIPGAGVPAPGRQSGICFSRLAVTAGRLIFILSHLH-----LTNFTNSRCAT 152
           G   G   P P    G    RL V    L FILSH+H     L+ F+  RC++
Sbjct: 792 GMASGGQNPRPSTSRGT--QRLYVRLNTLHFILSHVHALDKSLSFFSRGRCSS 842


>12_01_0498 -
           3955300-3955317,3955399-3955503,3955600-3955677,
           3955764-3955838,3956339-3956425,3956507-3956574,
           3957604-3957691,3957794-3957894,3957967-3958087,
           3958434-3958556,3958687-3958752
          Length = 309

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 14/39 (35%), Positives = 20/39 (51%)
 Frame = +3

Query: 3   PAGRIPGAGVPAPGRQSGICFSRLAVTAGRLIFILSHLH 119
           P GR+P AG P+P       F R+ + + + I  LS  H
Sbjct: 161 PEGRLPAAGPPSPAEHLREVFYRMGL-SDKEIVALSGAH 198


>11_01_0419 +
           3226224-3226756,3228010-3228169,3228256-3228435,
           3228525-3228659,3229262-3229344,3229442-3229535,
           3229649-3229735
          Length = 423

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 2/39 (5%)
 Frame = -2

Query: 271 RPDGGA--SHDRGKHCARSIISCEAGLAHTGAIVYYQRG 161
           R DG +  SH+ G   ++  +S  AGL   GA+V+ QRG
Sbjct: 339 RADGNSKLSHEIGLELSK--MSTAAGLRPIGAVVFMQRG 375


>08_01_0552 - 4842417-4842632,4842878-4843378
          Length = 238

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 15/54 (27%), Positives = 24/54 (44%)
 Frame = -2

Query: 319 VPHLLHKSPSVPYRPSRPDGGASHDRGKHCARSIISCEAGLAHTGAIVYYQRGN 158
           VP L   + + PY  +  DGG + + G    +  I   +G A+  A    + GN
Sbjct: 136 VPFLALGAAAAPYSGNGSDGGFAREHGMDAEQVKIDIPSGAANAAADADARGGN 189


>01_05_0612 - 23652121-23652400,23653031-23654427
          Length = 558

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 11/29 (37%), Positives = 13/29 (44%)
 Frame = -2

Query: 277 PSRPDGGASHDRGKHCARSIISCEAGLAH 191
           P  P G   HDRG+   R   SC+    H
Sbjct: 487 PGIPQGDEEHDRGESTGRVAQSCDGLCGH 515


>08_02_1402 -
           26786011-26786128,26786263-26786516,26787505-26787732,
           26788920-26789759
          Length = 479

 Score = 26.2 bits (55), Expect = 9.4
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = -2

Query: 262 GGASHDRGKHCARSIISCEAGLAHTGA 182
           GG+S+DRG    + I  C+  +  TGA
Sbjct: 391 GGSSNDRGSALPKEISFCDQTVVPTGA 417


>08_02_1037 - 23851750-23852132,23852622-23852784
          Length = 181

 Score = 26.2 bits (55), Expect = 9.4
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = -2

Query: 343 GSGYLFCSVPHLLHKSPSVPYRPSRPDGGAS 251
           GSG    + P      P+ P  PS+P GGAS
Sbjct: 129 GSGTPPSTTPGSSGTPPATPSSPSKPTGGAS 159


>05_05_0017 + 21546434-21546841
          Length = 135

 Score = 26.2 bits (55), Expect = 9.4
 Identities = 10/16 (62%), Positives = 10/16 (62%)
 Frame = -2

Query: 49  CRPGAGTPAPGILPAG 2
           CRPG   PAP   PAG
Sbjct: 67  CRPGEPVPAPSSSPAG 82


>04_04_0212 + 23646043-23646369,23646457-23647304,23647409-23649158
          Length = 974

 Score = 26.2 bits (55), Expect = 9.4
 Identities = 11/35 (31%), Positives = 18/35 (51%)
 Frame = +3

Query: 186 PVCARPASQDMMLLAQCFPRSWEAPPSGRDGRYGT 290
           P+C+ P   +++ + Q    S E  P G DG  G+
Sbjct: 256 PLCSDPERANILTIMQAVGASGEWAPRGHDGAGGS 290


>02_05_1214 + 34976814-34979813
          Length = 999

 Score = 26.2 bits (55), Expect = 9.4
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +3

Query: 12  RIPGAGVPAPGRQ 50
           R+P AGVPAPG +
Sbjct: 104 RVPAAGVPAPGEE 116


>01_05_0698 + 24376193-24376708
          Length = 171

 Score = 26.2 bits (55), Expect = 9.4
 Identities = 15/44 (34%), Positives = 19/44 (43%)
 Frame = -3

Query: 387 VIPVSGDSVFDGVFEGQDTSFALCLISYIRVLLSHTDHHALMAG 256
           V PV+G  V      G    F  CL  Y+R    H + HA + G
Sbjct: 124 VAPVAGVLVMGADVAGVSALFGFCLAEYLR----HNEAHAAVDG 163


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,930,715
Number of Sequences: 37544
Number of extensions: 307980
Number of successful extensions: 998
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 953
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 998
length of database: 14,793,348
effective HSP length: 74
effective length of database: 12,015,092
effective search space used: 672845152
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).