SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0034
         (628 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_0117 + 26605186-26605443,26605540-26605583,26605659-266057...    30   1.3  
07_01_0566 + 4207894-4207974,4208090-4208144,4208671-4208759,420...    29   3.0  
06_03_1363 - 29576265-29577575                                         28   5.3  
02_01_0404 - 2945611-2948802                                           28   5.3  
05_04_0406 + 21022469-21022918                                         27   9.2  
01_06_0873 + 32617428-32617532,32618166-32618234,32619195-326193...    27   9.2  

>01_06_0117 +
           26605186-26605443,26605540-26605583,26605659-26605737,
           26605822-26605944,26606300-26606482,26606562-26606648,
           26608149-26608255,26608387-26608474,26608805-26608885,
           26608983-26609059,26609183-26609318,26609548-26609610,
           26609983-26610563,26610816-26610933
          Length = 674

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 23/100 (23%), Positives = 44/100 (44%), Gaps = 1/100 (1%)
 Frame = +1

Query: 187 LFKKMLRRQYSHESGKTELVKSSEEYLDRRR-TRSLNAPSPIQQVWTMRQDYEKFRHGHA 363
           +F+  +R   S   G T +++    +  +RR  R+L     + +   M   Y    HG+ 
Sbjct: 91  IFEATVRDPSSELYGSTVVLRQLMSFQAKRRGRRALEVLKKLARRQMMYHSYAMQVHGYV 150

Query: 364 NPGSGVAEADLVKPPLTVLVIKKVHDAQILAPFVQLVHWL 483
            PG+ V + D      + +++   H +  L  ++QL  WL
Sbjct: 151 TPGNDVEQDD-----GSFILVHGYHGSYSLRHWLQLSDWL 185


>07_01_0566 +
           4207894-4207974,4208090-4208144,4208671-4208759,
           4209742-4209794,4209966-4210120,4210201-4210528,
           4210618-4210730,4211394-4211538,4211951-4212259,
           4212340-4212420,4212989-4213349
          Length = 589

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +3

Query: 351 PWSCKSRIRRRRG*PGQASPHRAGHQESSRRPDTGTLR 464
           P+  +S +RR RG P  +SP R   ++ SR      LR
Sbjct: 449 PYGARSPVRRYRGSPRASSPSRYPRRDRSRSRSRSPLR 486


>06_03_1363 - 29576265-29577575
          Length = 436

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 15/32 (46%), Positives = 17/32 (53%)
 Frame = +2

Query: 371 DPASQRLTWSSLPSPCWSSRKFTTPRYWHPSF 466
           DP + R  W +LPSP   S     P  WHPSF
Sbjct: 130 DPLAGR--WDALPSPPMPS---PPPMLWHPSF 156


>02_01_0404 - 2945611-2948802
          Length = 1063

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 1/57 (1%)
 Frame = -3

Query: 443 AS*TFLMTSTVRGGLTRSASA-TPDPGFA*PWRNFS*SCRMVQTCCIGDGAFRDLVL 276
           AS T   T   R  L +  S  + D G A  WRN +  C+     C  DG   D+ L
Sbjct: 38  ASPTSSCTEQERSSLLQFLSGLSNDGGLAVSWRNAADCCKWEGVTCSADGTVTDVSL 94


>05_04_0406 + 21022469-21022918
          Length = 149

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 21/62 (33%), Positives = 26/62 (41%)
 Frame = +1

Query: 271 RRRTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQI 450
           RR TR   APS  ++         +   G A  G G    D   PP  VLVI  VH++  
Sbjct: 20  RRATRK--APSAAKEWGHRGAGASQTGVGGAADGGGCGPCDEATPPSAVLVIIVVHNSST 77

Query: 451 LA 456
            A
Sbjct: 78  AA 79


>01_06_0873 +
           32617428-32617532,32618166-32618234,32619195-32619380,
           32619687-32619776,32620389-32620462,32621149-32621260,
           32621413-32621468,32621826-32621880,32621965-32622021,
           32622696-32622797,32623467-32623547,32623756-32623808,
           32625245-32625314,32626540-32626603,32627339-32627487,
           32627564-32627719,32628011-32628108,32628763-32628847,
           32628932-32628997,32629066-32629125,32629408-32629494,
           32630307-32630360,32630538-32630576,32630651-32630779,
           32630859-32630911,32630984-32631032,32632240-32632298,
           32633111-32633259,32633338-32633492,32633719-32633847,
           32633932-32634017,32634220-32634335,32634429-32634541,
           32635335-32635458,32635540-32635658,32636289-32636490,
           32636586-32636757,32637852-32638176,32638442-32638529,
           32638970-32639059,32639169-32639370,32639681-32639705
          Length = 1450

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 18/51 (35%), Positives = 27/51 (52%)
 Frame = -3

Query: 305 GDGAFRDLVLLLSKYSSELLTSSVLPDSWEYCLRNIFLNRAITATRIHTEL 153
           G+ AFR LVL L  +   L +SS++ +S       +FLN  +  TR+   L
Sbjct: 274 GEPAFRRLVLRLVAHVIRLYSSSLVTES------EVFLNMLVKVTRLDLPL 318


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,096,628
Number of Sequences: 37544
Number of extensions: 445506
Number of successful extensions: 1192
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1158
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1192
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1525730988
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).