SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0031
         (558 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_01_0418 - 3288844-3288990,3289256-3289332,3289578-3289653,329...    30   1.4  
05_06_0043 + 25143513-25143866,25144010-25144191,25144284-251443...    28   4.4  
02_05_0624 - 30451032-30451140,30451294-30451409,30451506-304515...    28   5.8  
05_03_0089 - 8327044-8327142,8327238-8327306,8327413-8327504,832...    27   7.7  
03_05_0834 - 28051067-28051381,28051675-28052120,28052330-280526...    27   7.7  

>05_01_0418 -
           3288844-3288990,3289256-3289332,3289578-3289653,
           3290125-3290220,3290307-3290376,3290474-3290564,
           3290753-3290822,3290908-3291044,3291313-3291465,
           3291816-3291864,3292205-3292366
          Length = 375

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +3

Query: 180 YQRTHCPLVSKGGGTNCSSAFLGGARYPSYFELHSTGRSI*TIP 311
           +Q T  P  +  G T+C  AF+GG  Y  Y      GR +  IP
Sbjct: 295 FQSTTFPGAATSGVTDCQQAFIGGIAYGGYAR-KIVGRVLRKIP 337


>05_06_0043 +
           25143513-25143866,25144010-25144191,25144284-25144374,
           25144452-25144568,25144922-25144976,25145008-25145093,
           25145190-25145300,25145564-25145608,25145695-25145740,
           25146078-25146152,25146902-25146971,25147128-25147437,
           25147778-25147851,25147996-25148151,25148416-25148539
          Length = 631

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 10/28 (35%), Positives = 18/28 (64%)
 Frame = +1

Query: 145 LEAAGSQDWCSDTRERTARWYRKVEEQI 228
           +E   S+  CS+T E+  RWY + +E++
Sbjct: 246 IETIRSEFSCSETCEKLQRWYGETDEEV 273


>02_05_0624 -
           30451032-30451140,30451294-30451409,30451506-30451580,
           30452033-30452093,30452198-30452424
          Length = 195

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +2

Query: 116 VVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNK 226
           +VD    DQ  K   +R    I E+  P G ++WRNK
Sbjct: 146 LVDELLSDQHLKNYRMRKVREIQESRTPGGSQKWRNK 182


>05_03_0089 -
           8327044-8327142,8327238-8327306,8327413-8327504,
           8327932-8329042
          Length = 456

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 11/39 (28%), Positives = 17/39 (43%)
 Frame = +1

Query: 166 DWCSDTRERTARWYRKVEEQIVRQRS*VALGIPATLNYI 282
           DW   T  RTA+WY      +        LG+P  ++ +
Sbjct: 30  DWLPITSSRTAKWYYSAFHNVTAMVGAGVLGLPFAMSQL 68


>03_05_0834 -
           28051067-28051381,28051675-28052120,28052330-28052671,
           28053170-28053310,28053419-28053489,28053575-28053640,
           28053874-28054017,28054149-28054207,28054246-28054369,
           28054730-28054862,28055138-28055187,28055715-28055824,
           28057355-28057436,28057536-28057705,28057812-28058498,
           28058645-28058794,28058908-28059039,28059444-28059594,
           28060253-28060344,28062478-28062585
          Length = 1190

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = -2

Query: 98  LGALSLLMLVRLAHRKLKTSLPFYLLKTS 12
           LG LS L ++RLA+ KL  S+P  L + +
Sbjct: 722 LGQLSKLQILRLAYNKLSGSIPGSLFQVA 750


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,861,547
Number of Sequences: 37544
Number of extensions: 350482
Number of successful extensions: 877
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 825
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 877
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1269546012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).