SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0028
         (633 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_02_0362 + 7860088-7860197,7861606-7861636,7861738-7861801,786...    38   0.009
01_05_0652 - 23934604-23934636,23934783-23934893,23935000-239351...    35   0.062
08_02_0499 - 17820615-17822516,17823224-17823373,17823491-178235...    32   0.44 
06_03_1298 + 29141578-29141623,29142129-29142250,29143818-291438...    31   1.0  
06_01_0675 + 4937309-4937354,4937606-4937718,4937810-4937905,493...    31   1.0  
01_01_0552 - 4065623-4065698,4066133-4066218                           30   1.3  
04_04_1591 + 34647817-34648416                                         29   2.3  
02_02_0453 + 10420585-10421661,10422015-10422146,10422232-104224...    29   2.3  
01_06_0802 + 32087661-32087965,32088106-32088220,32088302-320884...    29   2.3  
10_01_0326 + 3574129-3574329,3575144-3575692,3575914-3576072,357...    29   3.1  
06_03_1471 + 30374988-30375959                                         29   3.1  
04_04_1536 - 34207425-34207490,34207801-34208268,34208345-342084...    29   3.1  
04_03_0752 + 19300584-19301273,19301335-19301723,19302861-19303539     29   3.1  
10_07_0061 + 12489552-12489674,12490761-12490836,12490916-124909...    29   4.1  
06_03_1470 + 30371391-30372353                                         29   4.1  
03_02_0994 - 13067254-13067379,13067483-13067521,13067824-130678...    29   4.1  
12_01_0030 + 262452-263210,263332-263575,263867-264165                 28   5.4  
11_04_0242 - 15273774-15274043,15274131-15274235                       28   5.4  
08_01_0436 + 3842143-3842850,3843140-3843314,3843829-3843911           28   5.4  
05_01_0360 + 2814139-2814627,2815203-2815334,2815480-2815583,281...    28   5.4  
04_04_1385 - 33157557-33157655,33157752-33158201,33158864-331590...    28   5.4  
02_02_0341 + 9141556-9142654,9143357-9143454                           28   5.4  
01_07_0360 + 43056226-43057566                                         28   5.4  
10_08_0753 + 20324011-20324113,20324210-20324231,20324344-203244...    28   7.1  
07_03_1258 + 25244863-25245282,25246419-25246568,25246665-252468...    28   7.1  
04_04_1538 + 34239913-34241274,34241468-34241578                       28   7.1  
03_06_0341 - 33261210-33261327,33261411-33262057,33262950-332630...    28   7.1  
01_05_0653 - 23948911-23948937,23949031-23949141,23949361-239494...    28   7.1  
09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052,174...    27   9.4  
08_02_0773 + 21043553-21043813,21044775-21045203                       27   9.4  
06_03_1495 + 30566992-30567084,30567181-30567235,30567320-30567507     27   9.4  
02_04_0413 + 22681957-22682035,22682253-22682788                       27   9.4  
01_07_0016 - 40476014-40476333,40476598-40476740,40476945-404790...    27   9.4  

>09_02_0362 +
           7860088-7860197,7861606-7861636,7861738-7861801,
           7861922-7862052,7863575-7863784,7863891-7863956,
           7864868-7865075,7866270-7866325,7866406-7867128,
           7868246-7868299,7868667-7868695,7869501-7869585,
           7870032-7870202,7870246-7870827
          Length = 839

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 26/102 (25%), Positives = 50/102 (49%)
 Frame = -1

Query: 504 IEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE 325
           ++Q   Q+   N L    H    Q+  Q+Q + ++ L   +  QH   +   +PL  QQ 
Sbjct: 659 LQQQQNQLQQQNQLHQ-QHQLQPQNQLQQQHQLQQQLQQQQLQQHMQLQTQGLPLQQQQS 717

Query: 324 VPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCP 199
             H L+QQ++Q ++Q  +QQ ++ +   + + +   Q+ Q P
Sbjct: 718 QGHPLQQQQMQ-QMQQQQQQQQIQQMQQQQQMQQMQQQQQQP 758



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 2/93 (2%)
 Frame = -1

Query: 522 LCSFSSIEQTLVQIHTGNVLEVLDHMG--SRQHMQQEQGECREPLAGLEQHQHSMAKQHR 349
           L + ++I   L   H   V EV        +Q +QQ+Q + ++     +QHQ     Q +
Sbjct: 626 LIAVAAISICLAVYHFSAVAEVPTQQPPMQQQQLQQQQNQLQQQNQLHQQHQ----LQPQ 681

Query: 348 MPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
             L  Q ++   L+QQ++Q+ +QL  Q + L +
Sbjct: 682 NQLQQQHQLQQQLQQQQLQQHMQLQTQGLPLQQ 714


>01_05_0652 -
           23934604-23934636,23934783-23934893,23935000-23935188,
           23935893-23936012,23936109-23936273,23936638-23936790,
           23936867-23936976,23937280-23937397,23938197-23938427,
           23938984-23939175,23939661-23939945,23940637-23940686,
           23940846-23940921,23941048-23941135,23941689-23941771,
           23941883-23942248,23942462-23942476,23942909-23943018,
           23943134-23943231,23943961-23944019
          Length = 883

 Score = 34.7 bits (76), Expect = 0.062
 Identities = 24/90 (26%), Positives = 43/90 (47%)
 Frame = -1

Query: 510 SSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ 331
           S +  + ++IH     +   HM +R+  QQ+Q +   P    +Q QH   +Q  +    Q
Sbjct: 81  SDVAASYIEIHH----KQTQHMKAREQQQQQQQQ--PPQQRQQQPQHIQMQQMLLQRAAQ 134

Query: 330 QEVPHLLEQQKVQRRVQL*EQQMELHRGYG 241
           Q+     +QQ+ Q++ Q  +QQ +  R  G
Sbjct: 135 QQQQQQQQQQQQQQQQQQQQQQQQQQRRDG 164


>08_02_0499 - 17820615-17822516,17823224-17823373,17823491-17823568,
            17823948-17824061,17824145-17824297,17826928-17827071,
            17827162-17827516,17828574-17828741,17829522-17829751,
            17829916-17830049,17830686-17830749
          Length = 1163

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 2/67 (2%)
 Frame = -1

Query: 450  HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPL--LGQQEVPHLLEQQKVQRRVQL 277
            + G +Q +Q  QG   +     +Q  + +  QH   L  L QQ++P    QQ   ++VQ 
Sbjct: 905  NQGDQQSLQTMQGYASQMWQYYQQQMYYLQAQHNQQLQSLQQQQLPTEHLQQNFMQQVQQ 964

Query: 276  *EQQMEL 256
              QQM L
Sbjct: 965  LNQQMVL 971



 Score = 27.9 bits (59), Expect = 7.1
 Identities = 19/60 (31%), Positives = 36/60 (60%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +Q +QQ+  + ++ L+ + Q Q +M +Q +   L QQ+   L +QQ+ Q+ V L +QQ +
Sbjct: 1070 QQLLQQQLLQQQQYLSQMPQQQQNMTQQQQ---LFQQQQQQLFQQQQ-QQMVVLQQQQQQ 1125


>06_03_1298 +
           29141578-29141623,29142129-29142250,29143818-29143874,
           29143983-29144138,29144220-29144304,29144575-29144665,
           29144807-29144971,29145064-29145186,29145334-29145409,
           29145513-29145642,29145951-29147824,29148339-29148529,
           29148697-29148860,29149164-29149275,29149276-29149294
          Length = 1136

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 4/80 (5%)
 Frame = -1

Query: 486 QIHTGNVLE----VLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVP 319
           QIH  + L+     ++HM      Q   G+ +  +    Q QH+ + Q + P   Q   P
Sbjct: 481 QIHDASNLQRQQPSMNHMLPLSQAQTNLGQAQVLVQNQMQQQHASSTQGQQPATSQ---P 537

Query: 318 HLLEQQKVQRRVQL*EQQME 259
            LL QQ+ Q++ Q  +QQ +
Sbjct: 538 LLLPQQQQQQQQQQQQQQQQ 557


>06_01_0675 +
           4937309-4937354,4937606-4937718,4937810-4937905,
           4938003-4938059,4938145-4938300,4938402-4938486,
           4938727-4938817,4938896-4939060,4939150-4939345,
           4939593-4939731,4940187-4941874,4942575-4942765,
           4942850-4942994
          Length = 1055

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = -1

Query: 456 LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK-VQRRVQ 280
           +DH    QH QQ     ++      Q    + +QH+  LL QQ   HL +QQ+ +QR+  
Sbjct: 482 VDHPVMSQHQQQPHQLSQQQQVQPSQQSSVVLQQHQAQLL-QQNAIHLQQQQEHLQRQQS 540

Query: 279 L*EQQME 259
              QQ++
Sbjct: 541 QPAQQLK 547


>01_01_0552 - 4065623-4065698,4066133-4066218
          Length = 53

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 2/32 (6%)
 Frame = +2

Query: 269 CSYSC--TLRCTFCCSNRCGTSCCPSSGILCC 358
           C Y+C  TL C FCC   C   CC     LCC
Sbjct: 25  CLYACLFTLCCCFCCYETC--ECCLE--CLCC 52


>04_04_1591 + 34647817-34648416
          Length = 199

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = +2

Query: 263 ICCSYSCTLRCTFCCSNRCGTSCCPSSG 346
           + C  +CT+     CS +C  SC P+ G
Sbjct: 172 LMCGKTCTMSAHTKCSAKCSKSCIPTCG 199


>02_02_0453 + 10420585-10421661,10422015-10422146,10422232-10422456,
            10422555-10422680,10422777-10422839,10423214-10423296,
            10424078-10424309,10424421-10424489,10424532-10424731,
            10424819-10424894,10425015-10425081,10425194-10425471,
            10425600-10425787,10426235-10426391,10426496-10426741
          Length = 1072

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 18/74 (24%), Positives = 32/74 (43%), Gaps = 1/74 (1%)
 Frame = +2

Query: 353  CCFAILCWCCSNPASGSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVCSIDEKEHKAFL 532
            C   +LC C      G L + C CC    +       S+   +  + V +++    ++ L
Sbjct: 821  CVPEVLCTCADQSYLGILLNCCLCCSLASILHAPLNESSARFYAASVVVALENLHQRSIL 880

Query: 533  QRLKTKD-LLVDKS 571
             R  + D L+VD+S
Sbjct: 881  YRGVSADILMVDRS 894


>01_06_0802 +
           32087661-32087965,32088106-32088220,32088302-32088421,
           32089678-32089788,32090084-32090122,32090965-32091069,
           32091149-32091187,32091923-32092015
          Length = 308

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 2/33 (6%)
 Frame = +2

Query: 386 NPASGSLHSPCSCCICC--RLPIWSSTSSTFPV 478
           NP    LH+P S       RLP+W ST S  PV
Sbjct: 32  NPPHRFLHAPSSPAAASPSRLPLWRSTGSLLPV 64


>10_01_0326 +
           3574129-3574329,3575144-3575692,3575914-3576072,
           3576349-3577543,3577626-3577762,3578052-3578242,
           3578888-3579218
          Length = 920

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 23/68 (33%), Positives = 33/68 (48%)
 Frame = -1

Query: 456 LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL 277
           LD    RQ  Q +Q    + L   +Q Q    +Q ++    QQE PH    Q +Q +VQ+
Sbjct: 454 LDEQHQRQDHQPKQNHPHDELQHQKQ-QPEQQQQDQVQQQQQQEQPH---DQHLQ-QVQM 508

Query: 276 *EQQMELH 253
            +QQ  LH
Sbjct: 509 HDQQQPLH 516


>06_03_1471 + 30374988-30375959
          Length = 323

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = +2

Query: 380 CSNPASGSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVCS 502
           C + A G+L   C  C+CC    W  ++S +    C S CS
Sbjct: 23  CGSQAGGAL---CPNCLCCSQYGWCGSTSAYCGSGCQSQCS 60


>04_04_1536 -
           34207425-34207490,34207801-34208268,34208345-34208485,
           34208582-34208820,34209950-34210436
          Length = 466

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 2/45 (4%)
 Frame = +2

Query: 230 PSLLP*PLCN-SICCSYSCTLRCTFCCSNRCGT-SCCPSSGILCC 358
           P   P  +C+ +  C    T  C F   N C    CCP  G  CC
Sbjct: 378 PPSAPDHVCDDNFSCPAGSTCCCAFGFRNLCLVWGCCPVEGATCC 422


>04_03_0752 + 19300584-19301273,19301335-19301723,19302861-19303539
          Length = 585

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 20/60 (33%), Positives = 29/60 (48%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           RQ MQQ+Q   R  L  LEQ Q   A Q ++ L  QQ+   +   Q+ Q  +   +Q  +
Sbjct: 477 RQRMQQQQALQRRQLF-LEQQQQQAALQQQLMLEQQQQQQMMAALQQQQLAILFHDQPQQ 535


>10_07_0061 + 12489552-12489674,12490761-12490836,12490916-12490980,
            12491089-12491166,12492156-12492236,12492813-12492974,
            12493328-12493426,12493509-12494797,12495063-12495286,
            12495373-12495500,12495596-12495634,12495724-12497178
          Length = 1272

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
            +Q MQ +Q   + PL   +  Q    +Q +     QQ+     +QQ+ Q+++Q  +QQM
Sbjct: 1117 QQQMQLQQQFQQNPLQQQQLQQLQQQQQQQQQQQIQQQQQQQQQQQQQQQQIQQQQQQM 1175



 Score = 27.9 bits (59), Expect = 7.1
 Identities = 13/41 (31%), Positives = 25/41 (60%)
 Frame = -1

Query: 381  QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            Q Q  + +Q +   L QQ++  L +QQ+ Q++ Q+ +QQ +
Sbjct: 1117 QQQMQLQQQFQQNPLQQQQLQQLQQQQQQQQQQQIQQQQQQ 1157


>06_03_1470 + 30371391-30372353
          Length = 320

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = +2

Query: 380 CSNPASGSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVCS 502
           C + A G+L   C  C+CC    W  ++S +    C S CS
Sbjct: 21  CGSQAGGAL---CPNCLCCSQYGWCGSTSDYCGAGCQSQCS 58


>03_02_0994 -
           13067254-13067379,13067483-13067521,13067824-13067893,
           13068025-13068116,13068237-13068319,13068590-13068633,
           13068682-13068800,13068883-13068915,13069152-13069239,
           13069364-13069413
          Length = 247

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 22/89 (24%), Positives = 32/89 (35%), Gaps = 5/89 (5%)
 Frame = +2

Query: 248 PLCNSI--C--CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSP 415
           P CN +  C  C    T+ C  C + +     C + G+ C     C  C           
Sbjct: 30  PCCNDVFHCRHCHNESTVICLVCDTEQPVAQVCYNCGV-CMGEYFCSACKFFDDDVR--- 85

Query: 416 CSCCICCRLPIW-SSTSSTFPVWICTSVC 499
           C CC+ C   IW +  +ST  +      C
Sbjct: 86  CRCCLLCFCWIWLTGNTSTAKIAASAGSC 114


>12_01_0030 + 262452-263210,263332-263575,263867-264165
          Length = 433

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 12/31 (38%), Positives = 14/31 (45%)
 Frame = +2

Query: 329 CCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           C P      CF  LC  C  P +  LH PC+
Sbjct: 324 CSPVQNYNACFGRLCSFCDEPRT-ILHPPCA 353


>11_04_0242 - 15273774-15274043,15274131-15274235
          Length = 124

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 9/26 (34%), Positives = 13/26 (50%)
 Frame = +2

Query: 368 LCWCCSNPASGSLHSPCSCCICCRLP 445
           +C CC  P    + +PC   I C +P
Sbjct: 78  VCTCCGGPHGVCIPAPCCYAINCNIP 103


>08_01_0436 + 3842143-3842850,3843140-3843314,3843829-3843911
          Length = 321

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 416 CSCCICCRLP 445
           C CC CCRLP
Sbjct: 128 CGCCCCCRLP 137


>05_01_0360 +
           2814139-2814627,2815203-2815334,2815480-2815583,
           2816180-2816292,2818409-2818506,2818636-2818815,
           2818893-2819114,2819270-2819404,2819489-2819771,
           2819858-2819931,2820164-2820384,2820463-2820550,
           2820651-2820744,2820827-2821015,2821369-2821400,
           2821542-2821621,2821718-2821807,2821911-2821980,
           2822240-2822285,2822370-2822428,2822588-2822753,
           2822929-2823107,2823186-2823392,2823529-2823633,
           2823701-2823703
          Length = 1152

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 19/77 (24%), Positives = 37/77 (48%)
 Frame = -1

Query: 462 EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
           EV +  G  Q  Q+EQGE  E  +G E+ Q    +     +  ++E    + +++ +   
Sbjct: 33  EVEEEEGEEQ--QEEQGEEEEGFSGDEEEQEVEGEADGEQVEEEEEEESSVGEEEAEAEG 90

Query: 282 QL*EQQMELHRGYGRSE 232
           +  E+++E  +G G  E
Sbjct: 91  EEEEEEVEEEQGAGEEE 107


>04_04_1385 -
           33157557-33157655,33157752-33158201,33158864-33159004,
           33159058-33159329,33160371-33160821
          Length = 470

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 3/46 (6%)
 Frame = +2

Query: 230 PSLLP*P-LC-NSICCSYSCTLRCTFCCSNRC-GTSCCPSSGILCC 358
           PS  P P +C N   C  S T  C +     C    CCP  G  CC
Sbjct: 370 PSPTPPPTVCDNYYTCPDSTTCCCIYEYGKYCYAWGCCPLEGATCC 415


>02_02_0341 + 9141556-9142654,9143357-9143454
          Length = 398

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 13/53 (24%), Positives = 22/53 (41%)
 Frame = -2

Query: 446 WVAGSICSRSRESVGSRWQDWSSTSIVWRSSIGCRYWGSKRCRTYWSSKRCSV 288
           WV G  C    + +  R +D  + +++   S  C    +K   T W    CS+
Sbjct: 33  WVGGDHCHMFSKLLSIRCEDCPNLTVLLLPSFECSISDTKDINTIWFPNLCSL 85


>01_07_0360 + 43056226-43057566
          Length = 446

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 21/65 (32%), Positives = 26/65 (40%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           CN IC   +C++         CG   C +    C  AI C    NP +  LH P   C  
Sbjct: 317 CN-ICFEQACSMEV-----KECGHQMCAA----CTLAICCHSKPNPKTLLLHPP--ACPF 364

Query: 434 CRLPI 448
           CR  I
Sbjct: 365 CRTTI 369


>10_08_0753 +
           20324011-20324113,20324210-20324231,20324344-20324400,
           20324704-20324785,20324903-20324998,20325265-20325389,
           20325484-20325502,20325598-20325744
          Length = 216

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 4/23 (17%)
 Frame = +2

Query: 305 CSNRCGTSCCP----SSGILCCF 361
           CS RCG S CP    ++ + CCF
Sbjct: 71  CSGRCGESNCPEVCLATEVFCCF 93


>07_03_1258 +
           25244863-25245282,25246419-25246568,25246665-25246877,
           25246979-25247068,25247311-25247424,25247881-25248150,
           25248251-25248407,25248691-25248741,25248742-25248819,
           25249357-25249457,25249832-25250002,25250136-25250210,
           25251527-25251793
          Length = 718

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 6/52 (11%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCC---SNRCGTSCCPSSGILC-CFAIL-CW-CCSNPASGS 403
           CCS      C  CC    N+    C      +C  FA L C+ CC+   SGS
Sbjct: 665 CCSRLADCLCCMCCIKACNKMNDQCAIVMTQVCAAFACLGCYECCAELCSGS 716


>04_04_1538 + 34239913-34241274,34241468-34241578
          Length = 490

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 6/37 (16%)
 Frame = +2

Query: 266 CCSYS-CTLRCTFCCS----NRCGT-SCCPSSGILCC 358
           C  YS C    T CC+    N C    CCP  G  CC
Sbjct: 395 CDRYSKCPAGTTCCCNYGIRNHCIVWGCCPVEGATCC 431


>03_06_0341 -
           33261210-33261327,33261411-33262057,33262950-33263061,
           33263313-33264097,33264797-33264867,33266323-33266635
          Length = 681

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 19/70 (27%), Positives = 32/70 (45%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           QH QQ+Q +  +     +Q    + +QH+     QQ+ P  L+QQ  Q+      Q  +L
Sbjct: 537 QHQQQQQQQQFQQQHQQQQQSQQLQQQHQ-----QQQQPQQLQQQHQQQLAMSGGQNAQL 591

Query: 255 HRGYGRSEGR 226
            +    S G+
Sbjct: 592 AQQLAMSGGQ 601



 Score = 27.5 bits (58), Expect = 9.4
 Identities = 17/64 (26%), Positives = 31/64 (48%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q    +QH+     QQ      +QQ+ Q+  Q  +QQ+ 
Sbjct: 523 QQVQQQQQQQQQQFQHQQQQQQQQFQQQHQQQQQSQQLQQQHQQQQQPQQLQQQHQQQLA 582

Query: 258 LHRG 247
           +  G
Sbjct: 583 MSGG 586


>01_05_0653 -
           23948911-23948937,23949031-23949141,23949361-23949441,
           23949865-23949984,23950088-23950252,23950344-23950493,
           23950565-23950674,23951401-23951518,23951597-23951827,
           23952345-23952524,23953639-23953908,23954930-23954979,
           23955213-23955288,23955396-23955483,23956010-23956101,
           23956200-23956529,23957484-23957593,23957810-23957907,
           23959538-23959566
          Length = 811

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = -1

Query: 384 EQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           +Q  H    QH+   + Q  +    +QQ+ Q++ Q  +QQ +LHR
Sbjct: 92  QQQYHHQQHQHQQIQMQQMLLQRAAQQQQQQQQQQQ-QQQQQLHR 135


>09_01_0112 +
           1737438-1737777,1738441-1738511,1738974-1739052,
           1741559-1741641,1741733-1741784,1742038-1742105,
           1742279-1742345,1742426-1742505,1742576-1742640,
           1742785-1742847,1743271-1743427,1743511-1743588,
           1743677-1744219,1744321-1744497,1744534-1744788,
           1745270-1745329,1745874-1745888,1746123-1746135,
           1746819-1746934
          Length = 793

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 18/61 (29%), Positives = 35/61 (57%), Gaps = 6/61 (9%)
 Frame = -1

Query: 426 QQEQGECREPLAGLEQHQHSMAKQH-RMPLLGQ-----QEVPHLLEQQKVQRRVQL*EQQ 265
           QQ+Q + ++ L  L+QHQ  +A Q  + P   Q     Q V  + + Q+ Q+++Q+ +Q+
Sbjct: 668 QQQQQQQQQKLLLLQQHQQKLAMQQLQSPPQAQTHPAMQPVQQIPQAQQGQQQMQMKQQE 727

Query: 264 M 262
           +
Sbjct: 728 L 728


>08_02_0773 + 21043553-21043813,21044775-21045203
          Length = 229

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = -1

Query: 246 YGRSEGRCCYQRTQCPAGDINLCSVWRN 163
           Y  ++  CCY R+  PA D  +  +W N
Sbjct: 40  YCDTKQSCCYPRSGKPAADFGIHGLWPN 67


>06_03_1495 + 30566992-30567084,30567181-30567235,30567320-30567507
          Length = 111

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 14/62 (22%), Positives = 27/62 (43%)
 Frame = -2

Query: 440 AGSICSRSRESVGSRWQDWSSTSIVWRSSIGCRYWGSKRCRTYWSSKRCSVGCSYRSSKW 261
           A +  S S   +  + Q   + S++    I C+   S RC   W  + C+  C+   ++ 
Sbjct: 20  AAAASSSSHPQLVQQMQVKRARSLLQAPKIDCQGTCSGRCANNWKKEMCNKMCNVCCNRC 79

Query: 260 SC 255
           +C
Sbjct: 80  NC 81


>02_04_0413 + 22681957-22682035,22682253-22682788
          Length = 204

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 12/38 (31%), Positives = 14/38 (36%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSS 343
           P   P P  +  CC  +    C  C    CG   CP S
Sbjct: 95  PPPSPSPCVHPPCCESAAGCCCNGCSGGGCGGGQCPPS 132



 Score = 27.5 bits (58), Expect = 9.4
 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 2/46 (4%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS--CCIC 433
           CC +  G  C   SG  C       C  +P+  + H PC   CC C
Sbjct: 107 CCESAAGCCCNGCSGGGCGGG---QCPPSPSCENHHPPCKPGCCCC 149


>01_07_0016 - 40476014-40476333,40476598-40476740,40476945-40479099,
            40479205-40480047,40480176-40480269,40480356-40481207,
            40481367-40481437,40481750-40481821,40481977-40482019
          Length = 1530

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 18/60 (30%), Positives = 32/60 (53%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            R   + EQ + R+ L   EQHQ  + ++    LL QQ+     +QQ++    Q+ +QQ++
Sbjct: 863  RVQFELEQQQRRQQLQQ-EQHQRQLQQRQAQQLLQQQQQQQQQQQQQLILE-QMLQQQLQ 920


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,581,335
Number of Sequences: 37544
Number of extensions: 281712
Number of successful extensions: 1235
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 1121
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1196
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1549385732
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).