SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0027
         (611 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_06_0294 + 22022630-22024006,22024109-22024234,22024319-220244...    30   1.3  
11_06_0278 - 21854859-21855101,21855529-21855587,21855684-218557...    30   1.3  
08_01_0038 - 282431-283954                                             28   5.1  
06_01_0092 - 775290-775691                                             28   6.7  

>11_06_0294 +
           22022630-22024006,22024109-22024234,22024319-22024423,
           22024525-22024659,22024798-22024847,22026487-22026545,
           22026819-22026928,22027941-22028174,22028278-22028377,
           22028699-22028829,22029834-22029914,22029970-22030128
          Length = 888

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/48 (33%), Positives = 23/48 (47%)
 Frame = +1

Query: 298 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFAL 441
           L+R +   PF SW N  +A  D+ +  L  LNG    +   + LK  L
Sbjct: 399 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNGRAAALIEKVNLKRGL 446


>11_06_0278 -
           21854859-21855101,21855529-21855587,21855684-21855711,
           21855812-21856702,21856792-21857011,21857638-21857687,
           21863174-21863284,21863379-21863483,21863568-21863693,
           21863796-21865187
          Length = 1074

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/48 (33%), Positives = 23/48 (47%)
 Frame = +1

Query: 298 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFAL 441
           L+R +   PF SW N  +A  D+ +  L  LNG    +   + LK  L
Sbjct: 404 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNGRAAALIEKVNLKRGL 451


>08_01_0038 - 282431-283954
          Length = 507

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = +3

Query: 369 FPTVAQ-PEWRMANCKR*YFVKIRVKFLLNQLIF*PIGRNRQNPL*IKE*TRDRVECCSS 545
           FP++A+ P  R   C + Y VK R   LL+QLI     + R + L   +   D ++   S
Sbjct: 227 FPSLARLPVVRRLLCAKAYHVKRRWDQLLDQLIDDHASKRRSSMLDNNDEESDFIDVLLS 286

Query: 546 LEQE 557
           ++QE
Sbjct: 287 IQQE 290


>06_01_0092 - 775290-775691
          Length = 133

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 12/18 (66%), Positives = 15/18 (83%)
 Frame = -1

Query: 356 RASSLLRQLAKGGCAARR 303
           RA+SLLRQL + GCAA +
Sbjct: 22  RAASLLRQLIEDGCAAAK 39


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,710,354
Number of Sequences: 37544
Number of extensions: 345676
Number of successful extensions: 896
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 873
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 896
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1466594128
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).