SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0026
         (630 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731...   192   1e-49
11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306...   190   6e-49
05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32...   190   6e-49
01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782...   190   6e-49
12_02_1282 + 27528159-27529148,27529549-27529614                      190   8e-49
10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910...   188   3e-48
12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323...   187   6e-48
05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585...   187   7e-48
03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137...   186   1e-47
01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054...   186   2e-47
08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981...   106   1e-23
02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980...    96   2e-20
08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160...    96   2e-20
08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207...    83   2e-16
04_03_0738 + 19169764-19169897,19169987-19170116,19170614-191706...    52   5e-07
01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931...    49   4e-06
01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238...    45   6e-05
07_03_0401 + 17724103-17724463,17724554-17724683,17725068-177250...    43   2e-04
03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324...    40   0.001
07_03_0143 - 14315097-14315130,14315594-14315662,14316152-143162...    40   0.002
04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182...    30   1.7  
12_02_0823 + 23461423-23462124                                         29   2.3  
07_03_1239 + 25077597-25077684,25077779-25078419                       29   2.3  
11_07_0015 + 27418462-27418917                                         29   3.0  
09_02_0266 - 6455957-6456412                                           29   3.0  
03_01_0470 + 3619417-3619572,3619681-3619759,3620017-3620258,362...    29   4.0  
10_08_0029 + 14270945-14271364,14271449-14272486                       28   5.3  
03_06_0331 - 33181757-33181795,33182325-33182453,33182941-331829...    28   5.3  
02_04_0179 + 20682852-20684510,20684593-20684661,20684741-206848...    28   5.3  
08_01_1006 - 10191817-10191822,10192449-10192745,10192826-101929...    28   7.0  
07_03_0263 - 15951011-15951818,15952009-15952526,15952949-159531...    28   7.0  
03_06_0030 + 31161821-31161927,31163700-31163934,31164064-311648...    28   7.0  
03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093     28   7.0  
03_03_0251 - 15849211-15851457                                         28   7.0  
02_02_0572 + 11667455-11670783,11672026-11672419                       28   7.0  
12_02_0800 + 23299674-23299678,23299714-23299791,23299876-232999...    27   9.3  
12_01_0843 + 7891622-7892524                                           27   9.3  
08_01_1074 - 11009766-11009819,11010274-11010472,11010555-110108...    27   9.3  
08_01_0855 + 8407411-8407628,8408231-8408267                           27   9.3  
07_03_0207 - 15183894-15184685,15184993-15185078,15186042-151861...    27   9.3  
07_01_0847 + 6884862-6884902,6884943-6885546                           27   9.3  
06_03_1231 + 28580006-28580934,28581810-28582086                       27   9.3  
03_06_0106 - 31682200-31682775                                         27   9.3  
03_03_0279 - 16134422-16134608,16134703-16134947,16135046-161353...    27   9.3  
03_02_0154 + 5967512-5967658,5968206-5968652,5968766-5968846,596...    27   9.3  
02_05_0477 - 29339649-29340253,29340880-29341492                       27   9.3  
02_05_0376 + 28406547-28406870                                         27   9.3  

>03_05_0926 +
           28871800-28871859,28871943-28872336,28872586-28873199,
           28873281-28873346
          Length = 377

 Score =  192 bits (469), Expect = 1e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  110 bits (265), Expect = 8e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>11_01_0403 +
           3059650-3059709,3059807-3060200,3060275-3060930,
           3060979-3061044
          Length = 391

 Score =  190 bits (464), Expect = 6e-49
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  110 bits (265), Expect = 8e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>05_01_0047 -
           323097-323162,323287-323900,324233-324626,324718-324777
          Length = 377

 Score =  190 bits (464), Expect = 6e-49
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  110 bits (265), Expect = 8e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>01_07_0285 -
           42476767-42476832,42476990-42477603,42477821-42478214,
           42478301-42478360
          Length = 377

 Score =  190 bits (464), Expect = 6e-49
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  110 bits (265), Expect = 8e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>12_02_1282 + 27528159-27529148,27529549-27529614
          Length = 351

 Score =  190 bits (463), Expect = 8e-49
 Identities = 91/112 (81%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  109 bits (262), Expect = 2e-24
 Identities = 49/59 (83%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   DDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>10_08_0597 +
           19089616-19089675,19089789-19090182,19090451-19091064,
           19091160-19091225
          Length = 377

 Score =  188 bits (458), Expect = 3e-48
 Identities = 89/112 (79%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETF+ PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFETFSVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  110 bits (265), Expect = 8e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>12_01_0409 -
           3230853-3230918,3231372-3231994,3232454-3232847,
           3233000-3233059
          Length = 380

 Score =  187 bits (456), Expect = 6e-48
 Identities = 89/112 (79%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPALLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFE+FN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 123 QIMFESFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  110 bits (265), Expect = 8e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>05_04_0450 -
           21356877-21356942,21357482-21358095,21358173-21358566,
           21358648-21358704
          Length = 376

 Score =  187 bits (455), Expect = 7e-48
 Identities = 89/112 (79%), Positives = 92/112 (82%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPE+HPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEDHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GY LP
Sbjct: 122 QIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYTLP 173



 Score =  113 bits (271), Expect = 1e-25
 Identities = 50/62 (80%), Positives = 56/62 (90%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           M DE++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQ
Sbjct: 1   MADEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 250 SK 255
           +K
Sbjct: 61  AK 62


>03_06_0585 -
           34912159-34912224,34912634-34913247,34913350-34913734,
           34913824-34913883
          Length = 374

 Score =  186 bits (454), Expect = 1e-47
 Identities = 89/112 (79%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG   +      T +    P  +GYALP
Sbjct: 123 QIMFETFNAPAMYVAIQAVLSLYASGRIVLDSGDGVTHT---VPIYEGYALP 171



 Score =  110 bits (265), Expect = 8e-25
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>01_06_1455 +
           37504175-37504231,37504357-37504750,37504865-37505478,
           37506021-37506086
          Length = 376

 Score =  186 bits (452), Expect = 2e-47
 Identities = 88/112 (78%), Positives = 92/112 (82%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP+NPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +G+ LP
Sbjct: 122 QIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFTLP 173



 Score =  112 bits (270), Expect = 2e-25
 Identities = 50/62 (80%), Positives = 56/62 (90%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           M +E++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQ
Sbjct: 1   MAEEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>08_02_0441 -
           17196352-17196536,17196780-17196906,17198018-17198101,
           17198282-17198348,17198575-17198633,17199211-17199336,
           17199406-17199474,17199545-17199653,17199692-17199760,
           17199876-17199979,17200518-17200567,17200696-17200774,
           17200867-17200938,17201083-17201217,17201311-17201421,
           17202088-17202129
          Length = 495

 Score =  106 bits (255), Expect = 1e-23
 Identities = 49/108 (45%), Positives = 67/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP  NREKM + MF
Sbjct: 66  LDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKMIETMF 125

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E +N   +++ +QAVLSLYA G+       S    +   P   G++ P
Sbjct: 126 EKYNFAGVFIQVQAVLSLYAQGLLTGLVIDSGDGVTHVVPVVDGFSYP 173



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>02_04_0473 +
           23197294-23197340,23197443-23197680,23197792-23198016,
           23198616-23198762,23198827-23198961,23199415-23199507,
           23199925-23200044,23200303-23200413,23200486-23200611,
           23200731-23200829,23201024-23201104
          Length = 473

 Score = 96.3 bits (229), Expect = 2e-20
 Identities = 45/92 (48%), Positives = 56/92 (60%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 449
           L YPI +G V NWD ME+ W    +N LR  PE+H  LLTE+PL P   RE   +IMFET
Sbjct: 87  LSYPIHNGQVENWDTMERFWQQCIFNYLRCDPEDHYFLLTESPLTPPETREYTGEIMFET 146

Query: 450 FNTPAMYVAIQAVLSLYASGVPPVSCWTSATV 545
           FN P +Y+A Q VL+L A+G     C  +  V
Sbjct: 147 FNVPGLYIACQPVLAL-AAGYTTTKCEMTGVV 177



 Score = 34.7 bits (76), Expect = 0.061
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 177
           A+V+DNG+G  K GFAG+  P  + P++V
Sbjct: 8   AVVIDNGTGYTKMGFAGNVEPCFITPTVV 36



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 10/17 (58%), Positives = 13/17 (76%)
 Frame = +2

Query: 515 TGIVLDFGDGVFHTVPI 565
           TG+V+D GDG  H VP+
Sbjct: 174 TGVVVDVGDGATHIVPV 190


>08_01_0194 -
           1603702-1603782,1603970-1604062,1604203-1604328,
           1604403-1604513,1604989-1605108,1605665-1605757,
           1606024-1606157,1606503-1606530,1606821-1607075,
           1607167-1607401,1608147-1608193
          Length = 440

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 41/82 (50%), Positives = 57/82 (69%)
 Frame = +3

Query: 258 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 437
           G+ T K+PI HG V +WD ME+ W    +N LR  PEEH  LLT++P++   +RE   +I
Sbjct: 82  GLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYFLLTDSPVSTPESRECAGEI 141

Query: 438 MFETFNTPAMYVAIQAVLSLYA 503
           MFETFN P +Y+++Q+VLSL A
Sbjct: 142 MFETFNVPGLYISVQSVLSLSA 163



 Score = 34.3 bits (75), Expect = 0.081
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 177
           A+V+DNG+G  K GF+G+  P    P++V
Sbjct: 8   AVVIDNGTGYSKLGFSGNSEPCFTIPTVV 36



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 10/17 (58%), Positives = 13/17 (76%)
 Frame = +2

Query: 515 TGIVLDFGDGVFHTVPI 565
           TG+V+D GDG  H VP+
Sbjct: 188 TGVVVDIGDGAPHVVPV 204


>08_01_0254 +
           2078380-2078392,2078487-2078578,2079579-2079698,
           2079924-2080097,2080184-2080257,2080847-2080927,
           2081306-2081366,2081437-2081486,2082278-2082332,
           2082599-2082676,2082757-2082810,2083703-2083756,
           2083846-2083906,2084229-2084280,2085118-2085184,
           2085393-2085452,2085546-2085608,2085752-2085814,
           2086337-2086401,2086620-2086688,2086742-2086847
          Length = 503

 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 34/77 (44%), Positives = 51/77 (66%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P++ G VT+WD ++ IW+H F   L + PEEHP+L+ E   N    REK  ++MFE +  
Sbjct: 137 PMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTNTGQQREKAAELMFEKYKV 196

Query: 459 PAMYVAIQAVLSLYASG 509
           PA+++A  AVL+ +ASG
Sbjct: 197 PALFLAKNAVLTSFASG 213



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 174
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36


>04_03_0738 +
           19169764-19169897,19169987-19170116,19170614-19170687,
           19171208-19171288,19172054-19172087
          Length = 150

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 425
           P++ G   +WD ++ IW+H F   L + PEEHP+L+ E   N    REK
Sbjct: 92  PMKDGTFIDWDIVDNIWNHAFRQRLLINPEEHPMLIVEPSTNTGQQREK 140


>01_01_1170 -
           9318332-9318461,9318551-9318613,9318694-9318744,
           9318837-9318921,9319005-9319068,9319139-9319340,
           9319808-9320502
          Length = 429

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 1/109 (0%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           +TL+ PI+ G + N +   ++W     N L+V P    +LL E   NP A +    +++F
Sbjct: 60  MTLRRPIDRGYLINQEVQREVWERVIRNLLQVDPNNSSLLLVEPQFNPPALQHATDELVF 119

Query: 444 ETFNTPAMYVA-IQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E     ++ VA   +++ LY +   P S + +       C F+  +A P
Sbjct: 120 EELGFKSLCVADAPSLVHLYEASRQP-SLFRAQCSLVVDCGFSFTHASP 167



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           +V+DNG G+ KAGF GD  P AV P+ + +P
Sbjct: 8   VVLDNGGGLLKAGFGGDMNPTAVVPNCMAKP 38


>01_01_0292 -
           2387653-2387711,2388061-2388684,2388814-2389104,
           2389338-2389390,2390496-2390968,2391090-2391432,
           2391793-2391911,2392081-2392512,2392657-2392747,
           2392833-2392942,2393681-2393875,2394581-2394622,
           2395144-2395268,2395856-2395926,2396047-2396147
          Length = 1042

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/66 (28%), Positives = 37/66 (56%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 449
           ++ P +  +V  ++ ME I    F      +   HP+L+TE   NP  +R +M++++FET
Sbjct: 82  IRSPFDDDVVYQFEYMEYILDFGFDRLGATSEVGHPILMTECECNPSFSRARMSELLFET 141

Query: 450 FNTPAM 467
           +  P++
Sbjct: 142 YGVPSI 147



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 240
           +V+DNG+   + G+AG+  PR  F +IV RPRH+      G+  + VGD
Sbjct: 22  IVIDNGASTFRIGWAGEAEPRVAFRNIVQRPRHR----SSGETVTVVGD 66


>07_03_0401 +
           17724103-17724463,17724554-17724683,17725068-17725083,
           17725130-17725203,17725693-17725761,17726224-17726257
          Length = 227

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 19/49 (38%), Positives = 27/49 (55%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 425
           P++ G   +WD ++ IW+H F       PEEHP+L+ E   N    REK
Sbjct: 173 PMKDGTFIDWDIVDNIWNHAF----SFYPEEHPMLIVEPSTNTGQQREK 217


>03_06_0192 +
           32230953-32231030,32231130-32231485,32232250-32232425,
           32233857-32234038,32234260-32234443,32235192-32235259,
           32235343-32235495
          Length = 398

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/34 (55%), Positives = 24/34 (70%)
 Frame = +3

Query: 408 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 509
           +A RE++ Q+MFE FN    Y + QAVLSLYA G
Sbjct: 156 QALREQLAQLMFEKFNVSGFYDSEQAVLSLYAVG 189



 Score = 27.9 bits (59), Expect = 7.0
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFA-GDDAPRAVFPS 171
           A+VVD GS + KAG A  D +P  V PS
Sbjct: 3   AVVVDAGSKLLKAGIALPDQSPSLVMPS 30


>07_03_0143 -
           14315097-14315130,14315594-14315662,14316152-14316225,
           14316316-14316331,14316716-14316845,14316936-14316999
          Length = 128

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 425
           P++ G   +WD ++ IW+H F        EEHP+L+ E   N    REK
Sbjct: 74  PMKDGTFIDWDIVDNIWNHAF----SFYAEEHPMLIVEPSTNTGQQREK 118


>04_04_1515 +
           34117383-34117732,34117833-34117918,34118227-34118297,
           34118457-34118524,34118692-34118753,34119010-34119107,
           34119545-34119626,34119935-34120077,34120233-34120381,
           34120461-34120594,34120714-34120832,34120926-34121014,
           34121398-34121515
          Length = 522

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 10/67 (14%)
 Frame = +3

Query: 336 TFYNELRVAPEEHPVLL---------TE-APLNPKANREKMTQIMFETFNTPAMYVAIQA 485
           T Y  ++V P   P+++         TE A  + K  R+ +  ++F+  N PA+    QA
Sbjct: 188 TIYTRMQVKPSTQPIIVVLPLCHSDDTESARASRKQYRDTLYSVLFD-MNVPAVCSVDQA 246

Query: 486 VLSLYAS 506
           VL+LYA+
Sbjct: 247 VLALYAA 253


>12_02_0823 + 23461423-23462124
          Length = 233

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 3/39 (7%)
 Frame = -2

Query: 260 TSLLCASSPT*ESFCPIPT---ITP*WRGLPTIEGNTAR 153
           TS+  A+  T  + CP P    +TP   G P+I GNTAR
Sbjct: 19  TSVAAATKLTLHNLCPYPVWPLVTPN-TGFPSISGNTAR 56


>07_03_1239 + 25077597-25077684,25077779-25078419
          Length = 242

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 15/46 (32%), Positives = 21/46 (45%)
 Frame = -2

Query: 584 KCVSFRKWARCGRHRRRSPARYRWYAGRVQREHGLDGDVHGGRVEC 447
           +C S+ +   C R RRR   R RW + R   +H       GG  +C
Sbjct: 198 RCSSWYEGLACHRRRRRRLGRQRWQSHREVSDHVCPAT--GGEFDC 241


>11_07_0015 + 27418462-27418917
          Length = 151

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 22/81 (27%), Positives = 33/81 (40%)
 Frame = -3

Query: 604 RKEWRGGSAYPFVNGHGVEDTVAEVQHDTGGTPDAYSESTAWMATYMAGVLNVSNMIWVI 425
           R+EWRG     + +G GVE  VA +       P        W+      V   S++ W++
Sbjct: 33  REEWRGDGREEWRSGEGVERGVATLLSLLDRLPLGLPPPRLWLHKVRWTVGERSSVQWLV 92

Query: 424 FSLLALGLRGASVSRTGCSSG 362
               +  +R    S T C SG
Sbjct: 93  GEERS-AVRQRDKSGTPCGSG 112


>09_02_0266 - 6455957-6456412
          Length = 151

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 22/81 (27%), Positives = 33/81 (40%)
 Frame = -3

Query: 604 RKEWRGGSAYPFVNGHGVEDTVAEVQHDTGGTPDAYSESTAWMATYMAGVLNVSNMIWVI 425
           R+EWRG     + +G GVE  VA +       P        W+      V   S++ W++
Sbjct: 33  REEWRGDGREEWRSGEGVERGVATLLSLLDRLPLGLPPPRLWLHKVRWTVGERSSVQWLV 92

Query: 424 FSLLALGLRGASVSRTGCSSG 362
               +  +R    S T C SG
Sbjct: 93  GEERS-AVRQRDKSGTPCGSG 112


>03_01_0470 +
           3619417-3619572,3619681-3619759,3620017-3620258,
           3620804-3621148,3623592-3624116
          Length = 448

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = -2

Query: 191 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 72
           WR  P +  + ARG S P + AL   +P++     +++ H
Sbjct: 251 WRRTPWVGAHAARGGSRPLRRALQGLDPVTIAAIFSTAEH 290


>10_08_0029 + 14270945-14271364,14271449-14272486
          Length = 485

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 3/38 (7%)
 Frame = -3

Query: 244 PHLLHKSPSVPY---RPSRPDGGAFPRSRGTRREEHHL 140
           PHL    P  P+   +PSR  GG  PRS   +R   H+
Sbjct: 380 PHLPQPPPPPPHFERQPSRRRGGGVPRSVKMQRSSSHV 417


>03_06_0331 -
           33181757-33181795,33182325-33182453,33182941-33182967,
           33183459-33183545,33183827-33183975,33185467-33185521,
           33185596-33187584,33188705-33188782
          Length = 850

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +2

Query: 398 PQPQGQQREDDPDHVRNIQH 457
           P    Q+  DDPDHV+N+ H
Sbjct: 393 PHETNQEDLDDPDHVKNLLH 412


>02_04_0179 +
           20682852-20684510,20684593-20684661,20684741-20684809,
           20686779-20688206
          Length = 1074

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 16/37 (43%), Positives = 17/37 (45%)
 Frame = -3

Query: 244 PHLLHKSPSVPYRPSRPDGGAFPRSRGTRREEHHLLR 134
           P    K P  P  P  PD  A  RSR TRR    +LR
Sbjct: 212 PDEASKLPPPPAPPPAPDDDAASRSRSTRRRLVKVLR 248


>08_01_1006 -
           10191817-10191822,10192449-10192745,10192826-10192975,
           10194558-10195370
          Length = 421

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -2

Query: 218 CPIPTITP*WRGLPTIEGNTARGASSPAK 132
           C +P   P +RG P++   T RG + PA+
Sbjct: 142 CDMPLAPPGFRGFPSLVSLTLRGVTLPAE 170


>07_03_0263 -
           15951011-15951818,15952009-15952526,15952949-15953197,
           15953270-15953857
          Length = 720

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 1/50 (2%)
 Frame = -1

Query: 264 GYLFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIIS-CETGLAH 118
           GY F  C+ +++ VL    DH  ++     D G      IIS C   L H
Sbjct: 447 GY-FKKCVDNFLHVLKQEEDHGPMVEEAKDDGGSTSEDEIISMCRNNLVH 495


>03_06_0030 + 31161821-31161927,31163700-31163934,31164064-31164826,
            31165816-31167650,31169294-31169424,31169993-31170075,
            31170426-31170680,31171125-31171220,31171695-31171775,
            31171811-31171968,31172434-31172534,31172614-31172629,
            31173390-31173439,31174558-31174588,31175156-31175305,
            31176135-31176173,31176288-31176410,31176496-31176552,
            31176837-31176911,31177003-31177107
          Length = 1496

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 4/33 (12%)
 Frame = -3

Query: 202  SRPDGGA---FPRSRGTRREEHHL-LRNRPCTY 116
            S+ D GA   +P+  GT R+  H+ ++NRPC +
Sbjct: 1333 SKADAGASKTYPQQAGTIRKNGHIVIKNRPCKW 1365


>03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093
          Length = 435

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = -3

Query: 229 KSPSVPYRPSRPDGGAFPR 173
           + P+V +RP+ PDGGA P+
Sbjct: 207 RCPTVQHRPTPPDGGAPPK 225


>03_03_0251 - 15849211-15851457
          Length = 748

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 13/34 (38%), Positives = 17/34 (50%)
 Frame = -3

Query: 277 YLRVRIPLCSVPHLLHKSPSVPYRPSRPDGGAFP 176
           + R  +P  ++P L H   S P  P RPD   FP
Sbjct: 42  FSRASLPRLALPLLRHLLLSSPLLPLRPDAFTFP 75


>02_02_0572 + 11667455-11670783,11672026-11672419
          Length = 1240

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 14/31 (45%), Positives = 16/31 (51%)
 Frame = +2

Query: 362 PRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ 454
           P     PA  GS  P G  R DDPD  RN++
Sbjct: 95  PSSASQPAAGGSKFP-GLSRPDDPDRARNLR 124


>12_02_0800 +
           23299674-23299678,23299714-23299791,23299876-23299920,
           23300052-23300415,23300493-23300574,23300793-23300873,
           23300974-23302106,23302202-23302350,23302426-23302516,
           23303628-23305940
          Length = 1446

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = -3

Query: 226 SPSVPYRPSRPDGGAFP 176
           +P  PYRP  P GG FP
Sbjct: 294 APGGPYRPLGPPGGGFP 310


>12_01_0843 + 7891622-7892524
          Length = 300

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAV 162
           E+V ++  D GSG  +AG  GD AP  V
Sbjct: 170 EDVTSVWRDGGSGAARAGDDGDGAPAFV 197


>08_01_1074 -
           11009766-11009819,11010274-11010472,11010555-11010805,
           11012049-11012199,11012596-11012710,11012930-11012993
          Length = 277

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = +3

Query: 489 LSLYASGVPPVSCWTS 536
           L L++ GVPP SCW S
Sbjct: 4   LLLWSEGVPPPSCWRS 19


>08_01_0855 + 8407411-8407628,8408231-8408267
          Length = 84

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = -1

Query: 432 GSSSLCWPWG*GEPQ*AGLGVPRGRHA 352
           GS+   W W    P  AG+GV RGR A
Sbjct: 20  GSNRWWWWWWWSSPAAAGIGVGRGRAA 46


>07_03_0207 -
           15183894-15184685,15184993-15185078,15186042-15186144,
           15186890-15186971,15187112-15187203,15187295-15187383,
           15187467-15187547,15188610-15188724,15188894-15188935
          Length = 493

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = -2

Query: 383 QDWVFLGGDTQLIVEGMMPNLLHVIPV 303
           Q W+   G T L+V  M P+L++V+ V
Sbjct: 13  QQWIDKEGKTPLMVASMRPDLINVVQV 39


>07_01_0847 + 6884862-6884902,6884943-6885546
          Length = 214

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 14/38 (36%), Positives = 18/38 (47%)
 Frame = -2

Query: 569 RKWARCGRHRRRSPARYRWYAGRVQREHGLDGDVHGGR 456
           R   R G  RRR  +  RW+A   +   G  G + GGR
Sbjct: 3   RTQIRLGGRRRRRGSAARWFATGGRSRGGRRGYIRGGR 40


>06_03_1231 + 28580006-28580934,28581810-28582086
          Length = 401

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -2

Query: 590 WGKCVSFRKWARCGRHRRRSPARYRWYAGR 501
           W   + FR ++R  R RRR+ AR R  +GR
Sbjct: 226 WWSFMFFRGFSRSSRRRRRARARERRGSGR 255


>03_06_0106 - 31682200-31682775
          Length = 191

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 15/37 (40%), Positives = 17/37 (45%)
 Frame = +3

Query: 504 SGVPPVSCWTSATVSSTPCPFTKGYALPPRHSLRFGT 614
           S  PP SCWT  T S  P     G+AL     +  GT
Sbjct: 120 SSAPPRSCWT-LTASHPPPRSAAGFALTTPFRVGVGT 155


>03_03_0279 -
           16134422-16134608,16134703-16134947,16135046-16135364,
           16135451-16135675,16135780-16135946,16136030-16136146,
           16136234-16136407,16136489-16136584,16136669-16136885,
           16137005-16137123,16137249-16137441,16137562-16137713,
           16137809-16137938,16138667-16138776
          Length = 816

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = +3

Query: 243 GTEQRGILTLKYPIEHGIVTNWDDMEKIW 329
           GTE   IL + +  E+GIV  W    ++W
Sbjct: 361 GTEHTHILRVPFRTENGIVRKWISRFEVW 389


>03_02_0154 +
           5967512-5967658,5968206-5968652,5968766-5968846,
           5969058-5969075,5969552-5969748,5969844-5969943,
           5970676-5970861
          Length = 391

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = -3

Query: 325 IFSMSSQLVTIPCSMGYLRVRIPLCSVPHLLHKSPSV 215
           IFS +S+  TIP S+   R ++ +  V +LL KS SV
Sbjct: 295 IFSRASEDRTIPLSVIAERTKLSISDVEYLLMKSLSV 331


>02_05_0477 - 29339649-29340253,29340880-29341492
          Length = 405

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 177
           + VAALV  N  G+ +    G+DA  A  PS++
Sbjct: 44  DAVAALVASNEDGVVEGEGEGEDAAEAPAPSVL 76


>02_05_0376 + 28406547-28406870
          Length = 107

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 1/47 (2%)
 Frame = +1

Query: 463 PCTSPSKPCSRCTRPAYHRYRAGLRRRCLPHRA-HLRKDTHFPHAIP 600
           PCTSPS   + C  P  H +      R    RA  L ++   P+  P
Sbjct: 2   PCTSPSCKATICRTPGNHHHGTTSELRAASRRASSLWEEMVLPYNFP 48


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,787,263
Number of Sequences: 37544
Number of extensions: 564506
Number of successful extensions: 2032
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 1907
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2017
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1537558360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).