SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0025
         (588 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_0270 - 24061852-24063264                                         30   1.2  
05_03_0373 - 13194723-13195847,13196219-13196809                       29   2.1  
07_01_0886 - 7356591-7356662,7357002-7357079,7357373-7357444,735...    28   4.8  
07_03_1789 - 29527145-29527204,29527277-29527358,29527457-295275...    28   6.3  
04_04_0844 - 28637393-28638118,28638206-28638283,28638431-286386...    27   8.4  
01_01_0963 - 7577207-7577992,7578506-7578622,7578711-7578921,757...    27   8.4  

>04_04_0270 - 24061852-24063264
          Length = 470

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
 Frame = -1

Query: 474 VGYSVGNLALPKFPILKDI--SYKSSLAV*A*HLVTLCPL 361
           V  +  +++LP  P L D+  S  +SLA    H+ TLCPL
Sbjct: 53  VSEASSSMSLPSLPSLSDVTGSMSASLAASFAHVTTLCPL 92


>05_03_0373 - 13194723-13195847,13196219-13196809
          Length = 571

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 12/33 (36%), Positives = 16/33 (48%)
 Frame = +2

Query: 248 LQKNNAEFRRYKCNTSCISGSFYSKRVHDGLQP 346
           L +    FR Y  N   + G FY  R+ DG+ P
Sbjct: 329 LSRYAGRFRHYDVNNEMLHGRFYRDRLGDGVAP 361


>07_01_0886 -
           7356591-7356662,7357002-7357079,7357373-7357444,
           7357511-7357600,7357669-7357783,7358509-7358639,
           7358717-7358992,7360147-7360283,7360368-7360502,
           7360958-7361325,7362111-7362229,7362295-7362339
          Length = 545

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +3

Query: 303 PVRSTPSASTMVSSQPLIMAEGTASPNVTLTP 398
           P R T +  T  + Q L+ AEG  SP  T++P
Sbjct: 105 PTRPTIALLTEEAKQRLLRAEGQTSPGTTVSP 136


>07_03_1789 -
           29527145-29527204,29527277-29527358,29527457-29527524,
           29527633-29527722,29527811-29527888,29527969-29528064,
           29528217-29528300,29528405-29528605,29528967-29529059,
           29529573-29529639,29530843-29530901,29531036-29531202,
           29531420-29531509,29531868-29531916,29532109-29532174,
           29532260-29532434,29532528-29532649
          Length = 548

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 17/49 (34%), Positives = 20/49 (40%)
 Frame = -1

Query: 588 DVVADVESFEFAFSHQILLKCLLPQQNNNFLCIGRHCTVGYSVGNLALP 442
           D+VA         SH  L  C+L  +N N L I      G   G L LP
Sbjct: 156 DIVALSGGHTLVASHS-LFPCMLKNENQNLLSINSELVSGEKEGLLQLP 203


>04_04_0844 -
           28637393-28638118,28638206-28638283,28638431-28638607,
           28639124-28639537
          Length = 464

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 16/42 (38%), Positives = 20/42 (47%)
 Frame = +3

Query: 237 QKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMA 362
           QKS     MP S   ++T A   V S PS     +  PL+MA
Sbjct: 298 QKSRSYATMPESPSKDSTTAQQSVPSPPSVGMAEALSPLLMA 339


>01_01_0963 -
           7577207-7577992,7578506-7578622,7578711-7578921,
           7579406-7579442,7580781-7580902,7581292-7581500
          Length = 493

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 9/26 (34%), Positives = 14/26 (53%)
 Frame = -2

Query: 521 CLSKTIIFSASDVTVRSVILSVIWHY 444
           C+    +FS S VT+   +  + WHY
Sbjct: 302 CMVADAVFSGSGVTIAGKVSGIHWHY 327


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,702,213
Number of Sequences: 37544
Number of extensions: 307430
Number of successful extensions: 818
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 809
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 818
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1388195172
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).