SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0023
         (531 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0466 - 34134138-34134278,34134355-34134481,34134558-341347...    93   2e-19
01_06_1253 - 35753546-35753686,35753759-35753885,35753970-357541...    93   2e-19
10_06_0053 - 10110617-10111271,10112023-10112417,10112565-101126...    81   7e-16
05_03_0026 + 7466017-7466034,7466340-7466405,7466572-7466833,746...    51   5e-07
12_01_0603 + 4937472-4938351,4938597-4938689,4938820-4939589,493...    29   3.1  
08_01_0473 - 4169754-4169938,4170039-4170121,4170297-4170347,417...    28   5.4  
03_01_0309 - 2432395-2433271,2433494-2434495,2434538-2435073,243...    27   7.1  
07_01_1198 + 11376510-11376644,11377471-11377620,11378254-11378397     27   9.4  

>03_06_0466 -
           34134138-34134278,34134355-34134481,34134558-34134713,
           34135831-34135835
          Length = 142

 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 42/48 (87%), Positives = 47/48 (97%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           +NDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct: 95  ENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142



 Score = 85.4 bits (202), Expect = 3e-17
 Identities = 37/48 (77%), Positives = 42/48 (87%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEK+G+EAKQPNSAIRKC RVQL+KNGKK+ AFVP DGCLN IE+
Sbjct: 48  GIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEE 95


>01_06_1253 -
           35753546-35753686,35753759-35753885,35753970-35754125,
           35754761-35754853,35757132-35757265,35757339-35757465,
           35757550-35757705,35758321-35758325
          Length = 312

 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 42/48 (87%), Positives = 47/48 (97%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           +NDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct: 265 ENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 312



 Score = 89.0 bits (211), Expect = 2e-18
 Identities = 40/46 (86%), Positives = 45/46 (97%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERP 118
           +NDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+P
Sbjct: 95  ENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 140



 Score = 85.4 bits (202), Expect = 3e-17
 Identities = 37/48 (77%), Positives = 42/48 (87%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEK+G+EAKQPNSAIRKC RVQL+KNGKK+ AFVP DGCLN IE+
Sbjct: 48  GIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEE 95



 Score = 85.4 bits (202), Expect = 3e-17
 Identities = 37/48 (77%), Positives = 42/48 (87%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEK+G+EAKQPNSAIRKC RVQL+KNGKK+ AFVP DGCLN IE+
Sbjct: 218 GIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEE 265


>10_06_0053 -
           10110617-10111271,10112023-10112417,10112565-10112650,
           10112973-10113021,10114164-10114290,10114372-10114526,
           10114730-10114948
          Length = 561

 Score = 80.6 bits (190), Expect = 7e-16
 Identities = 35/48 (72%), Positives = 41/48 (85%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEK+G+EAKQPNSAI KC RVQL+KNGKK+ AFVP DGCLN I++
Sbjct: 119 GIVLEKIGIEAKQPNSAICKCARVQLVKNGKKIAAFVPNDGCLNFIKE 166


>05_03_0026 +
           7466017-7466034,7466340-7466405,7466572-7466833,
           7467254-7467294
          Length = 128

 Score = 51.2 bits (117), Expect = 5e-07
 Identities = 22/27 (81%), Positives = 25/27 (92%)
 Frame = -1

Query: 249 DEVLVAGFGRKGHAVGDIPGVRFKVVK 169
           DEVL++GFG KGHAVGDI GVRF+VVK
Sbjct: 67  DEVLISGFGHKGHAVGDIRGVRFEVVK 93


>12_01_0603 +
           4937472-4938351,4938597-4938689,4938820-4939589,
           4939706-4939809,4940026-4940548,4940697-4941074
          Length = 915

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 17/61 (27%), Positives = 28/61 (45%)
 Frame = +1

Query: 262 WFRQPSRGTNAVTFFPFLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP 441
           W  +   GT   + F +  +  R   +  + GC++ TP  +RG P    P+VS +   W 
Sbjct: 134 WIIRSCGGTPHGSDFAYFHTIRRYTKQNTQFGCVSFTPRSNRGCP---WPLVSTMRTKWG 190

Query: 442 S 444
           S
Sbjct: 191 S 191


>08_01_0473 -
           4169754-4169938,4170039-4170121,4170297-4170347,
           4170434-4170507,4170585-4170679,4171672-4171754,
           4171848-4172104
          Length = 275

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = +1

Query: 4   SAAAEFGGRGSLGFYIL*TYKQRASRQQVTYHNVHL*SWS 123
           +AAAE GG G  G  +  T ++ A+ +   YH V    WS
Sbjct: 51  AAAAEGGGGGGGGKLVAETMRKYAAPRSSRYHGVTRLKWS 90


>03_01_0309 -
           2432395-2433271,2433494-2434495,2434538-2435073,
           2435579-2435716,2436050-2436148,2436278-2436346,
           2436968-2437063
          Length = 938

 Score = 27.5 bits (58), Expect = 7.1
 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 4/54 (7%)
 Frame = +3

Query: 81  TAGHLSQCTPMILVAPFSLCRERGET----RWLLLPP*NELRECHRRRDLYDRI 230
           T GH+++  P+ L     LCR   E     + ++  P  E  E H+  DL   I
Sbjct: 138 TTGHVAKAAPVFLDETIKLCRVYSEAAKSDQCIMSMPKEETTEEHKETDLTSNI 191


>07_01_1198 + 11376510-11376644,11377471-11377620,11378254-11378397
          Length = 142

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = -1

Query: 465 PVTTVVKRRPVNCNTTHYRANWDRAPPRESWCR 367
           PVT+V    PV+   TH+   W+R  P++ W R
Sbjct: 24  PVTSVPLSSPVS---THWERRWER-KPKKQWVR 52


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,254,573
Number of Sequences: 37544
Number of extensions: 333564
Number of successful extensions: 793
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 771
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 793
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1178343540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).