SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0021
         (393 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_0989 + 7672764-7672904,7673017-7673067,7673176-7673296,767...    45   3e-05
08_02_0721 + 20401217-20401360,20401689-20401809,20401969-204020...    41   3e-04
02_05_0684 - 30880527-30880753,30881952-30882124,30882687-308827...    39   0.001
03_05_0599 - 26012956-26013316,26013444-26013736,26013813-260140...    33   0.062
01_06_1395 + 37010446-37010895                                         32   0.14 
02_05_0042 + 25351648-25351724,25351983-25352010,25352311-253523...    31   0.33 
08_02_1409 - 26864544-26864658,26864787-26864916,26864953-268652...    31   0.44 
05_05_0038 - 21769936-21770199,21770785-21771198,21771274-217714...    31   0.44 
03_05_0843 + 28126480-28127007,28127092-28127457,28129388-281294...    29   1.8  
01_04_0054 - 15456668-15459691                                         27   4.1  
10_08_0877 + 21230447-21230815,21231855-21232208,21232417-212325...    27   5.4  
12_01_1055 - 10861665-10861829,10862827-10863171,10864374-108646...    27   7.1  
12_01_0179 - 1319291-1319332,1319884-1320579,1322759-1323207,132...    27   7.1  
10_07_0001 + 11698408-11698785,11698883-11699809                       27   7.1  
08_02_1379 - 26540012-26540587,26540804-26540995,26541777-265418...    27   7.1  
06_02_0050 - 10951725-10951910,10951988-10952021,10952521-109527...    27   7.1  
03_05_1070 + 30125131-30127029                                         27   7.1  
07_01_0968 - 8111340-8112067,8112496-8112566,8112663-8112837,811...    26   9.4  
02_04_0532 + 23711530-23711755,23712984-23713093,23713204-237152...    26   9.4  

>06_01_0989 +
           7672764-7672904,7673017-7673067,7673176-7673296,
           7673406-7673510,7673963-7674024,7674398-7674515,
           7674596-7674932,7675389-7675536,7675632-7675733,
           7675824-7675943,7676436-7676519,7676622-7676749,
           7677351-7677435,7677566-7677713,7677971-7678047,
           7678187-7678243,7678423-7678561,7678642-7678796,
           7679003-7679116,7679208-7679275,7679830-7679996,
           7680245-7680453
          Length = 911

 Score = 44.8 bits (101), Expect = 3e-05
 Identities = 23/65 (35%), Positives = 31/65 (47%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G+L K+ A   GW +RWFVL+    +L Y    E+ H +G I L E     +      PP
Sbjct: 584 GYLLKKSAKTNGWSRRWFVLNEKSGKLGYTKKQEERHFRGVITLEE--CNLEEVEEEEPP 641

Query: 73  KKCDD 59
           K   D
Sbjct: 642 KSLKD 646


>08_02_0721 +
           20401217-20401360,20401689-20401809,20401969-20402067,
           20402790-20402851,20403680-20403797,20404004-20404343,
           20404435-20404582,20405043-20405144,20405240-20405359,
           20405812-20405895,20405974-20406101,20408314-20408389,
           20408556-20408631,20408800-20408876,20408975-20409031,
           20409411-20409555,20409634-20409806,20409928-20410054,
           20410090-20410192,20410492-20410688,20410946-20411097
          Length = 882

 Score = 41.1 bits (92), Expect = 3e-04
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAE 116
           G L+K+ A    W  RWFVL+    +L Y    E+ H +G I+L E
Sbjct: 540 GFLFKKRAKANDWSNRWFVLNERSGKLGYTKKQEERHFRGVINLEE 585


>02_05_0684 -
           30880527-30880753,30881952-30882124,30882687-30882754,
           30882860-30882973,30883281-30883438,30883516-30883654,
           30883851-30883907,30884064-30884140,30884324-30884462,
           30884590-30884668,30885047-30885174,30885269-30885352,
           30886072-30886191,30886274-30886375,30886470-30886617,
           30887404-30887749,30887851-30887968,30888309-30888370,
           30888798-30888947,30889049-30889169,30889269-30889319,
           30889427-30889567
          Length = 933

 Score = 39.1 bits (87), Expect = 0.001
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAE 116
           G+L K+ A    W +RWFVL+    +L Y    E+ H +G I L E
Sbjct: 597 GYLLKKSAKNNEWSKRWFVLNEKSGKLGYTKKQEERHFRGVIVLEE 642


>03_05_0599 -
           26012956-26013316,26013444-26013736,26013813-26014040,
           26014666-26014897,26015392-26015475,26015562-26015623,
           26016263-26016367,26016458-26016481
          Length = 462

 Score = 33.5 bits (73), Expect = 0.062
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           +G L KR   L+ W +RW +LD    ++ Y     ++  KG I
Sbjct: 34  QGPLLKRSETLRKWNERWVILDPTSGKMEYKIRRNETAIKGTI 76


>01_06_1395 + 37010446-37010895
          Length = 149

 Score = 32.3 bits (70), Expect = 0.14
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = -3

Query: 283 VERRREQNARGHLYKRGALLKGWKQRWFVL 194
           VE  R     G L K+G  +K W++RWFVL
Sbjct: 16  VEFWRSPERAGWLTKQGEYIKTWRRRWFVL 45


>02_05_0042 +
           25351648-25351724,25351983-25352010,25352311-25352373,
           25352880-25352945,25353029-25353076,25353338-25353379,
           25353499-25353714,25354066-25354188,25354352-25354564,
           25354930-25355016,25355259-25355507,25356386-25356507,
           25357135-25357225,25358467-25358882,25359489-25359609
          Length = 653

 Score = 31.1 bits (67), Expect = 0.33
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDS 188
           +G+L+KR    + WK+R+FVLDS
Sbjct: 186 QGYLFKRSENSREWKRRFFVLDS 208


>08_02_1409 -
           26864544-26864658,26864787-26864916,26864953-26865283,
           26866507-26866626,26867489-26867821,26867915-26868001,
           26868093-26868320,26868434-26868565,26868649-26868861,
           26869376-26869417,26869829-26869894,26870230-26870274,
           26870367-26870429,26870757-26870827,26871149-26871249,
           26871458-26871534,26872415-26872459
          Length = 732

 Score = 30.7 bits (66), Expect = 0.44
 Identities = 16/32 (50%), Positives = 23/32 (71%), Gaps = 1/32 (3%)
 Frame = -3

Query: 256 RGHLYKRGALLKG-WKQRWFVLDSIKHQLRYY 164
           +G+L KR + L+  WK+R+FVLDS +  L YY
Sbjct: 247 QGYLSKRSSNLRADWKRRFFVLDS-RGMLYYY 277


>05_05_0038 -
           21769936-21770199,21770785-21771198,21771274-21771434,
           21771544-21771607,21771682-21771864,21772355-21772520,
           21773397-21773528,21775085-21775599
          Length = 632

 Score = 30.7 bits (66), Expect = 0.44
 Identities = 24/82 (29%), Positives = 36/82 (43%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G L K+G  +K W++RWFVL     Q R +   + +  +G +    VI V       G  
Sbjct: 42  GWLNKQGEYIKTWRRRWFVL----KQGRLFWFKDAAVTRGSVPRG-VIPVATCLTVKGAE 96

Query: 73  KKCDDRSFFDLRTSRRTYNFCA 8
              + +  F+L T   T  F A
Sbjct: 97  DVINRQFAFELSTPTDTMYFIA 118


>03_05_0843 +
           28126480-28127007,28127092-28127457,28129388-28129487,
           28130266-28130546,28130643-28130705,28131276-28131431,
           28131913-28132080,28132158-28132298,28132714-28132840,
           28132888-28132994,28134142-28134372,28134446-28134559,
           28135091-28135261
          Length = 850

 Score = 28.7 bits (61), Expect = 1.8
 Identities = 12/29 (41%), Positives = 13/29 (44%)
 Frame = -3

Query: 220 GWKQRWFVLDSIKHQLRYYDAMEDSHCKG 134
           GWK RWF  D      RY     +S  KG
Sbjct: 802 GWKPRWFAKDKATDTYRYLGGYWESREKG 830


>01_04_0054 - 15456668-15459691
          Length = 1007

 Score = 27.5 bits (58), Expect = 4.1
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -3

Query: 232 ALLKGWKQRWFVLDSIKHQLRYYDAME 152
           AL KGW  +W   D+ KH+   Y+A+E
Sbjct: 612 ALYKGWSMQW-SSDADKHRAYEYEAVE 637


>10_08_0877 +
           21230447-21230815,21231855-21232208,21232417-21232504,
           21232844-21233268,21233477-21233632,21233849-21234016,
           21234170-21234310,21234393-21234629,21234710-21234823,
           21235096-21235272
          Length = 742

 Score = 27.1 bits (57), Expect = 5.4
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL 194
           G LYK   + KGW+ RWF +
Sbjct: 52  GVLYKWTNIGKGWRPRWFAI 71


>12_01_1055 -
           10861665-10861829,10862827-10863171,10864374-10864682,
           10864813-10864968,10865669-10866117,10869275-10869359,
           10869944-10870300,10870672-10871076
          Length = 756

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 3/37 (8%)
 Frame = -3

Query: 223 KGWKQRWFVL---DSIKHQLRYYDAMEDSHCKGFIDL 122
           KGW+ RWF     DS ++   Y++A E  +  G  D+
Sbjct: 709 KGWQPRWFSKDDDDSYRYIGGYWEAREKGNWDGIPDI 745



 Score = 26.2 bits (55), Expect = 9.4
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLD 191
           G L+K     KGW+ RWFVL+
Sbjct: 58  GVLHKWVNYGKGWRLRWFVLE 78


>12_01_0179 - 1319291-1319332,1319884-1320579,1322759-1323207,
            1323291-1324903,1324991-1325077,1326983-1327251
          Length = 1051

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 12/42 (28%), Positives = 22/42 (52%)
 Frame = -3

Query: 199  VLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            VLD+I  +  ++D+M+ ++      LA+ +      P  GPP
Sbjct: 948  VLDNITGRFVHHDSMDGANLPAATRLADALRPLLPAPPQGPP 989


>10_07_0001 + 11698408-11698785,11698883-11699809
          Length = 434

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 9/28 (32%), Positives = 16/28 (57%)
 Frame = -3

Query: 157 MEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           +++ + + F+D  EV A  + TP   PP
Sbjct: 331 VDEQYIQSFVDFGEVAAGDELTPTAAPP 358


>08_02_1379 -
           26540012-26540587,26540804-26540995,26541777-26541812,
           26542255-26542488
          Length = 345

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 17/40 (42%), Positives = 20/40 (50%)
 Frame = +1

Query: 139 YSASLPSHRSIVADVLSSPTRTIFVSIP*VERLACRDALV 258
           YS+S P   SIV   +S       V+IP V RL   D LV
Sbjct: 38  YSSSCPKLESIVRYEVSRKINETVVTIPAVLRLFFHDCLV 77


>06_02_0050 -
           10951725-10951910,10951988-10952021,10952521-10952772,
           10953093-10954114
          Length = 497

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
 Frame = -3

Query: 205 WFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATP--APG 80
           +F  D    +++Y DA +     GF+DL + I  TQ T   APG
Sbjct: 332 YFATDDCPEKMQYMDAKKKKEPIGFLDLTQ-ICQTQHTVRLAPG 374


>03_05_1070 + 30125131-30127029
          Length = 632

 Score = 26.6 bits (56), Expect = 7.1
 Identities = 11/46 (23%), Positives = 24/46 (52%)
 Frame = -3

Query: 220 GWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAP 83
           G  +  + +D ++  +R++ A E+ H +     +   A+T+  PAP
Sbjct: 317 GATETLYDVDCVERVVRHFLAEEEDHGEAEASTSAAAAITEEAPAP 362


>07_01_0968 -
           8111340-8112067,8112496-8112566,8112663-8112837,
           8112991-8113054,8113351-8113671,8114413-8114438,
           8114495-8114573
          Length = 487

 Score = 26.2 bits (55), Expect = 9.4
 Identities = 15/65 (23%), Positives = 29/65 (44%)
 Frame = -3

Query: 196 LDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPPKKCDDRSFFDLRTSRRTYN 17
           L ++    +  D    S  +GF +        Q  P+PGP + C D + + +  +++ Y 
Sbjct: 410 LSNVSLSSKSADPWNCSLIEGFSNSVAPEICEQLRPSPGPGQVCYDGNSYPVPAAQQPYK 469

Query: 16  FCASR 2
             A+R
Sbjct: 470 SGATR 474


>02_04_0532 +
           23711530-23711755,23712984-23713093,23713204-23715298,
           23716092-23716153,23716236-23716277,23716614-23716673,
           23716873-23717010,23717333-23717374,23717452-23717574
          Length = 965

 Score = 26.2 bits (55), Expect = 9.4
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = -3

Query: 232 ALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           A+L G K++  +LDS++ +  YYD  +D
Sbjct: 880 AVLNGAKEKIQILDSMRMEKSYYDKDKD 907


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,966,279
Number of Sequences: 37544
Number of extensions: 166359
Number of successful extensions: 623
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 612
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 623
length of database: 14,793,348
effective HSP length: 74
effective length of database: 12,015,092
effective search space used: 672845152
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).