SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0018
         (502 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585...   221   2e-58
01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054...   221   2e-58
11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306...   221   3e-58
05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32...   221   3e-58
03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731...   221   3e-58
01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782...   221   3e-58
10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910...   220   4e-58
03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137...   220   6e-58
12_02_1282 + 27528159-27529148,27529549-27529614                      219   1e-57
12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323...   219   1e-57
08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981...   105   3e-23
08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160...    75   4e-14
02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980...    74   7e-14
01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931...    65   3e-11
08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207...    56   2e-08
01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238...    53   1e-07
04_03_0738 + 19169764-19169897,19169987-19170116,19170614-191706...    47   7e-06
03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324...    43   2e-04
07_03_0401 + 17724103-17724463,17724554-17724683,17725068-177250...    39   0.003
07_03_0143 - 14315097-14315130,14315594-14315662,14316152-143162...    36   0.024
04_04_1523 - 34148407-34150224                                         30   0.91 
05_05_0370 + 24466565-24468031                                         29   2.1  
05_05_0369 + 24461001-24462455                                         29   2.1  
03_01_0470 + 3619417-3619572,3619681-3619759,3620017-3620258,362...    29   2.8  
12_02_0147 + 14403046-14403285,14403371-14404078,14404145-14404702     28   3.7  
08_01_1006 - 10191817-10191822,10192449-10192745,10192826-101929...    28   4.8  
03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093     28   4.8  
03_01_0573 + 4230875-4231432                                           28   4.8  
12_02_0800 + 23299674-23299678,23299714-23299791,23299876-232999...    27   6.4  
12_01_0843 + 7891622-7892524                                           27   6.4  
07_01_0154 - 1094256-1094672,1094954-1094977,1095867-1095891,109...    27   6.4  
02_05_0477 - 29339649-29340253,29340880-29341492                       27   6.4  
07_01_0013 - 99952-100413,100534-100704                                27   8.5  

>05_04_0450 -
           21356877-21356942,21357482-21358095,21358173-21358566,
           21358648-21358704
          Length = 376

 Score =  221 bits (541), Expect = 2e-58
 Identities = 98/115 (85%), Positives = 106/115 (92%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           M DE++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +
Sbjct: 1   MADEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +KRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPE+HPVLLTEAPLNPKA
Sbjct: 61  AKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEDHPVLLTEAPLNPKA 115


>01_06_1455 +
           37504175-37504231,37504357-37504750,37504865-37505478,
           37506021-37506086
          Length = 376

 Score =  221 bits (541), Expect = 2e-58
 Identities = 98/115 (85%), Positives = 106/115 (92%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           M +E++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +
Sbjct: 1   MAEEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP+NPKA
Sbjct: 61  SKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKA 115


>11_01_0403 +
           3059650-3059709,3059807-3060200,3060275-3060930,
           3060979-3061044
          Length = 391

 Score =  221 bits (539), Expect = 3e-58
 Identities = 99/112 (88%), Positives = 105/112 (93%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 116


>05_01_0047 -
           323097-323162,323287-323900,324233-324626,324718-324777
          Length = 377

 Score =  221 bits (539), Expect = 3e-58
 Identities = 99/112 (88%), Positives = 105/112 (93%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 116


>03_05_0926 +
           28871800-28871859,28871943-28872336,28872586-28873199,
           28873281-28873346
          Length = 377

 Score =  221 bits (539), Expect = 3e-58
 Identities = 99/112 (88%), Positives = 105/112 (93%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 116


>01_07_0285 -
           42476767-42476832,42476990-42477603,42477821-42478214,
           42478301-42478360
          Length = 377

 Score =  221 bits (539), Expect = 3e-58
 Identities = 99/112 (88%), Positives = 105/112 (93%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 116


>10_08_0597 +
           19089616-19089675,19089789-19090182,19090451-19091064,
           19091160-19091225
          Length = 377

 Score =  220 bits (538), Expect = 4e-58
 Identities = 98/112 (87%), Positives = 105/112 (93%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKA 116


>03_06_0585 -
           34912159-34912224,34912634-34913247,34913350-34913734,
           34913824-34913883
          Length = 374

 Score =  220 bits (537), Expect = 6e-58
 Identities = 98/112 (87%), Positives = 104/112 (92%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKA 116


>12_02_1282 + 27528159-27529148,27529549-27529614
          Length = 351

 Score =  219 bits (535), Expect = 1e-57
 Identities = 98/112 (87%), Positives = 104/112 (92%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   DDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 116


>12_01_0409 -
           3230853-3230918,3231372-3231994,3232454-3232847,
           3233000-3233059
          Length = 380

 Score =  219 bits (535), Expect = 1e-57
 Identities = 98/112 (87%), Positives = 104/112 (92%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPALLTEAPLNPKA 116


>08_02_0441 -
           17196352-17196536,17196780-17196906,17198018-17198101,
           17198282-17198348,17198575-17198633,17199211-17199336,
           17199406-17199474,17199545-17199653,17199692-17199760,
           17199876-17199979,17200518-17200567,17200696-17200774,
           17200867-17200938,17201083-17201217,17201311-17201421,
           17202088-17202129
          Length = 495

 Score =  105 bits (251), Expect = 3e-23
 Identities = 50/107 (46%), Positives = 67/107 (62%), Gaps = 2/107 (1%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  +      D  VG      R  L
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLQEQELTDIVVGAACADLRHQL 66

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
            + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP
Sbjct: 67  DVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNP 113


>08_01_0194 -
           1603702-1603782,1603970-1604062,1604203-1604328,
           1604403-1604513,1604989-1605108,1605665-1605757,
           1606024-1606157,1606503-1606530,1606821-1607075,
           1607167-1607401,1608147-1608193
          Length = 440

 Score = 74.5 bits (175), Expect = 4e-14
 Identities = 44/123 (35%), Positives = 62/123 (50%), Gaps = 18/123 (14%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH---QGVMVG------------MGQKD 238
           A+V+DNG+G  K GF+G+  P    P++V        Q  M              M   D
Sbjct: 8   AVVIDNGTGYSKLGFSGNSEPCFTIPTVVAVNESFLDQSEMCSSANWIAQYNAGVMADLD 67

Query: 239 SYVGDGHKS---KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 409
            ++GD   S     G+ T K+PI HG V +WD ME+ W    +N LR  PEEH  LLT++
Sbjct: 68  FFIGDEALSLFKSSGLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYFLLTDS 127

Query: 410 PLN 418
           P++
Sbjct: 128 PVS 130


>02_04_0473 +
           23197294-23197340,23197443-23197680,23197792-23198016,
           23198616-23198762,23198827-23198961,23199415-23199507,
           23199925-23200044,23200303-23200413,23200486-23200611,
           23200731-23200829,23201024-23201104
          Length = 473

 Score = 73.7 bits (173), Expect = 7e-14
 Identities = 45/125 (36%), Positives = 63/125 (50%), Gaps = 19/125 (15%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRH---QGVMVG------MGQK 235
           A+V+DNG+G  K GFAG+  P  + P++V       G+ R    +G  +       M   
Sbjct: 8   AVVIDNGTGYTKMGFAGNVEPCFITPTVVAVNDTFAGQTRANTTKGNWMAQHSAGVMADL 67

Query: 236 DSYVGD---GHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 406
           D ++G+             L YPI +G V NWD ME+ W    +N LR  PE+H  LLTE
Sbjct: 68  DFFIGEDALARSRSSNTYNLSYPIHNGQVENWDTMERFWQQCIFNYLRCDPEDHYFLLTE 127

Query: 407 APLNP 421
           +PL P
Sbjct: 128 SPLTP 132


>01_01_1170 -
           9318332-9318461,9318551-9318613,9318694-9318744,
           9318837-9318921,9319005-9319068,9319139-9319340,
           9319808-9320502
          Length = 429

 Score = 64.9 bits (151), Expect = 3e-11
 Identities = 38/109 (34%), Positives = 55/109 (50%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNG G+ KAGF GD  P AV P+ + +P      +   Q  +   D      G +TL
Sbjct: 8   VVLDNGGGLLKAGFGGDMNPTAVVPNCMAKPPGSKKWLVADQLQAQDVD----VTG-MTL 62

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQ 433
           + PI+ G + N +   ++W     N L+V P    +LL E   NP ALQ
Sbjct: 63  RRPIDRGYLINQEVQREVWERVIRNLLQVDPNNSSLLLVEPQFNPPALQ 111


>08_01_0254 +
           2078380-2078392,2078487-2078578,2079579-2079698,
           2079924-2080097,2080184-2080257,2080847-2080927,
           2081306-2081366,2081437-2081486,2082278-2082332,
           2082599-2082676,2082757-2082810,2083703-2083756,
           2083846-2083906,2084229-2084280,2085118-2085184,
           2085393-2085452,2085546-2085608,2085752-2085814,
           2086337-2086401,2086620-2086688,2086742-2086847
          Length = 503

 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 23/59 (38%), Positives = 36/59 (61%)
 Frame = +2

Query: 242 YVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
           YVG   + +R  + +  P++ G VT+WD ++ IW+H F   L + PEEHP+L+ E   N
Sbjct: 120 YVGQELEFRRDHMEVISPMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTN 178



 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 187
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36


>01_01_0292 -
           2387653-2387711,2388061-2388684,2388814-2389104,
           2389338-2389390,2390496-2390968,2391090-2391432,
           2391793-2391911,2392081-2392512,2392657-2392747,
           2392833-2392942,2393681-2393875,2394581-2394622,
           2395144-2395268,2395856-2395926,2396047-2396147
          Length = 1042

 Score = 53.2 bits (122), Expect = 1e-07
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 3/114 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG---VMVGMGQKDSYVGDGHKSKRGI 277
           +V+DNG+   + G+AG+  PR  F +IV RPRH+     +  +G  D  +       R  
Sbjct: 22  IVIDNGASTFRIGWAGEAEPRVAFRNIVQRPRHRSSGETVTVVGDTDPALMKYFDCTRS- 80

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
             ++ P +  +V  ++ ME I    F      +   HP+L+TE   NP   + R
Sbjct: 81  -AIRSPFDDDVVYQFEYMEYILDFGFDRLGATSEVGHPILMTECECNPSFSRAR 133


>04_03_0738 +
           19169764-19169897,19169987-19170116,19170614-19170687,
           19171208-19171288,19172054-19172087
          Length = 150

 Score = 47.2 bits (107), Expect = 7e-06
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = +2

Query: 293 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
           P++ G   +WD ++ IW+H F   L + PEEHP+L+ E   N
Sbjct: 92  PMKDGTFIDWDIVDNIWNHAFRQRLLINPEEHPMLIVEPSTN 133


>03_06_0192 +
           32230953-32231030,32231130-32231485,32232250-32232425,
           32233857-32234038,32234260-32234443,32235192-32235259,
           32235343-32235495
          Length = 398

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 33/111 (29%), Positives = 52/111 (46%), Gaps = 2/111 (1%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           A+VVD GS + KAG A  D +P  V PS           + +  +D  +GDG   +  + 
Sbjct: 3   AVVVDAGSKLLKAGIALPDQSPSLVMPS----------KMKLEVEDGQMGDGAVVEEVV- 51

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELR-VAPEEHPVLLTEAPLNPKAL 430
               P+  G V +WD ME + ++  Y+ +     +E  +L TE    PK +
Sbjct: 52  ---QPVVRGFVKDWDAMEDLLNYVLYSNIGWEIGDEGQILFTEPLFTPKVI 99


>07_03_0401 +
           17724103-17724463,17724554-17724683,17725068-17725083,
           17725130-17725203,17725693-17725761,17726224-17726257
          Length = 227

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 17/52 (32%), Positives = 29/52 (55%)
 Frame = +2

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
           ++R  + +  P++ G   +WD ++ IW+H F       PEEHP+L+ E   N
Sbjct: 163 NRRDHMEVISPMKDGTFIDWDIVDNIWNHAF----SFYPEEHPMLIVEPSTN 210


>07_03_0143 -
           14315097-14315130,14315594-14315662,14316152-14316225,
           14316316-14316331,14316716-14316845,14316936-14316999
          Length = 128

 Score = 35.5 bits (78), Expect = 0.024
 Identities = 16/52 (30%), Positives = 28/52 (53%)
 Frame = +2

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
           ++R  + +  P++ G   +WD ++ IW+H F        EEHP+L+ E   N
Sbjct: 64  NRRDHMEVISPMKDGTFIDWDIVDNIWNHAF----SFYAEEHPMLIVEPSTN 111


>04_04_1523 - 34148407-34150224
          Length = 605

 Score = 30.3 bits (65), Expect = 0.91
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 2/70 (2%)
 Frame = +2

Query: 251 DGHKSKRGILTLKYPIEHGIV--TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           DG   + G  T  +PI+HG+    N +D    W H   + +  + EE   +    P+   
Sbjct: 316 DGGTGRFGCQTELFPIDHGLCLPENLEDPYFEWIHWAQSSIPFSEEELEYIKNLDPMRDV 375

Query: 425 ALQRRR*PQI 454
           A+ RR  P I
Sbjct: 376 AMLRRELPII 385


>05_05_0370 + 24466565-24468031
          Length = 488

 Score = 29.1 bits (62), Expect = 2.1
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +1

Query: 190 GKAPPSGRDGRYGTEGLLCRRWAQE 264
           G APP+G + R G  GLL R W  +
Sbjct: 321 GWAPPAGWEERVGDRGLLVRDWVPQ 345


>05_05_0369 + 24461001-24462455
          Length = 484

 Score = 29.1 bits (62), Expect = 2.1
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +1

Query: 190 GKAPPSGRDGRYGTEGLLCRRWAQE 264
           G APP+G + R G  GLL R W  +
Sbjct: 319 GWAPPAGWEERVGDRGLLVRDWVPQ 343


>03_01_0470 +
           3619417-3619572,3619681-3619759,3620017-3620258,
           3620804-3621148,3623592-3624116
          Length = 448

 Score = 28.7 bits (61), Expect = 2.8
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = -2

Query: 204 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 85
           WR  P +  + ARG S P + AL   +P++     +++ H
Sbjct: 251 WRRTPWVGAHAARGGSRPLRRALQGLDPVTIAAIFSTAEH 290


>12_02_0147 + 14403046-14403285,14403371-14404078,14404145-14404702
          Length = 501

 Score = 28.3 bits (60), Expect = 3.7
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 4/56 (7%)
 Frame = +2

Query: 113 VDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH----QGVMVGMGQKDSYVGDGHKSK 268
           ++N S   K GF      + V  +++G P H    +GV   M  K+ +  D HK +
Sbjct: 322 IENLSSSQKKGFFKPKREKDVLSTVLGTPEHGGRVRGVSSKMSWKEGFKHDPHKKR 377


>08_01_1006 -
           10191817-10191822,10192449-10192745,10192826-10192975,
           10194558-10195370
          Length = 421

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -2

Query: 231 CPIPTITP*WRGLPTIEGNTARGASSPAK 145
           C +P   P +RG P++   T RG + PA+
Sbjct: 142 CDMPLAPPGFRGFPSLVSLTLRGVTLPAE 170


>03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093
          Length = 435

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = -3

Query: 242 KSPSVPYRPSRPDGGAFPR 186
           + P+V +RP+ PDGGA P+
Sbjct: 207 RCPTVQHRPTPPDGGAPPK 225


>03_01_0573 + 4230875-4231432
          Length = 185

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 17/45 (37%), Positives = 22/45 (48%)
 Frame = +1

Query: 364 AACRPRGTPRPAY*GSPQPQGPTEEKMTPDSWFENNSTRPAMYRR 498
           AA  P   P PA   + +P    EEK TP SW +  ++  A  RR
Sbjct: 138 AATTPYARPSPAETKASEP----EEKKTPTSWLDLAASASAAARR 178


>12_02_0800 +
           23299674-23299678,23299714-23299791,23299876-23299920,
           23300052-23300415,23300493-23300574,23300793-23300873,
           23300974-23302106,23302202-23302350,23302426-23302516,
           23303628-23305940
          Length = 1446

 Score = 27.5 bits (58), Expect = 6.4
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = -3

Query: 239 SPSVPYRPSRPDGGAFP 189
           +P  PYRP  P GG FP
Sbjct: 294 APGGPYRPLGPPGGGFP 310


>12_01_0843 + 7891622-7892524
          Length = 300

 Score = 27.5 bits (58), Expect = 6.4
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAV 175
           E+V ++  D GSG  +AG  GD AP  V
Sbjct: 170 EDVTSVWRDGGSGAARAGDDGDGAPAFV 197


>07_01_0154 -
           1094256-1094672,1094954-1094977,1095867-1095891,
           1096014-1096304,1096391-1096470,1096953-1097052,
           1097143-1097204,1097650-1097750,1097940-1098117,
           1098298-1098924,1099014-1099100,1099804-1099905,
           1100265-1100348,1100580-1100657
          Length = 751

 Score = 27.5 bits (58), Expect = 6.4
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -1

Query: 268 FALVPISYIRVLLSHTDHHALMAGP-SHDRGKHCARSIISC 149
           F  V + ++ +LL H DH  L+    S D G HCA+ ++ C
Sbjct: 461 FDPVHVFHLLLLLLHYDHLVLVDYLISKDVGVHCAQYLLRC 501


>02_05_0477 - 29339649-29340253,29340880-29341492
          Length = 405

 Score = 27.5 bits (58), Expect = 6.4
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 190
           + VAALV  N  G+ +    G+DA  A  PS++
Sbjct: 44  DAVAALVASNEDGVVEGEGEGEDAAEAPAPSVL 76


>07_01_0013 - 99952-100413,100534-100704
          Length = 210

 Score = 27.1 bits (57), Expect = 8.5
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 266 CSCAHLLHKSPSVP 225
           C C H LH SPSVP
Sbjct: 142 CHCRHPLHLSPSVP 155


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,387,219
Number of Sequences: 37544
Number of extensions: 422863
Number of successful extensions: 1360
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 1293
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1356
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1059318940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).