SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0017
         (477 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_1137 - 26392399-26392613,26392828-26393233                       29   2.6  
07_03_0983 + 23124866-23125075,23125846-23125932,23126039-231262...    27   5.9  

>12_02_1137 - 26392399-26392613,26392828-26393233
          Length = 206

 Score = 28.7 bits (61), Expect = 2.6
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = +3

Query: 54  TNNQISNGFLFHENIRVNLLKCCYVSCYSFSLQ 152
           +N+ +S+G+ F  ++ V L +CC + CY    Q
Sbjct: 44  SNSGVSHGWTFVSDLEV-LTRCCMIDCYGGDAQ 75


>07_03_0983 +
           23124866-23125075,23125846-23125932,23126039-23126290,
           23126399-23126563,23126897-23126950,23127106-23127252,
           23127814-23128191
          Length = 430

 Score = 27.5 bits (58), Expect = 5.9
 Identities = 8/17 (47%), Positives = 13/17 (76%)
 Frame = +1

Query: 286 VNVEIWQIPREDNWLLQ 336
           +N+ +W+ P+E NW LQ
Sbjct: 299 INILVWKDPKEGNWWLQ 315


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,684,663
Number of Sequences: 37544
Number of extensions: 216237
Number of successful extensions: 470
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 468
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 470
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 979080328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).