SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0016
         (532 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_01_0226 + 1715211-1716761                                           31   0.58 
09_06_0073 + 20687057-20687246,20689004-20689203,20689786-206899...    31   0.58 
02_04_0437 - 22938263-22938273,22938345-22938444,22938727-229389...    31   0.76 
01_05_0564 + 23312419-23312987,23314652-23314751,23314832-233150...    29   1.8  
11_01_0228 + 1768318-1769871                                           29   2.3  
02_05_1142 - 34391144-34391590,34391715-34391904,34392058-343921...    28   5.4  
11_05_0023 - 18447015-18447410,18448156-18448308,18448679-184495...    27   9.4  
10_06_0084 - 10477880-10477897,10477940-10478002,10479523-104795...    27   9.4  
06_03_1167 + 28111923-28113218                                         27   9.4  

>12_01_0226 + 1715211-1716761
          Length = 516

 Score = 31.1 bits (67), Expect = 0.58
 Identities = 12/25 (48%), Positives = 19/25 (76%)
 Frame = +2

Query: 185 QDLDKAITKFTNLNEHTDEVLQDIL 259
           QD D  +++F   +EH+DEVL+DI+
Sbjct: 280 QDRDDVLSRFVASDEHSDEVLRDIV 304


>09_06_0073 +
           20687057-20687246,20689004-20689203,20689786-20689926,
           20689995-20690075,20690564-20690688,20690763-20690807,
           20691853-20691877,20692282-20693073
          Length = 532

 Score = 31.1 bits (67), Expect = 0.58
 Identities = 12/25 (48%), Positives = 19/25 (76%)
 Frame = +2

Query: 185 QDLDKAITKFTNLNEHTDEVLQDIL 259
           QD D  +++F   +EH+DEVL+DI+
Sbjct: 367 QDRDDVLSRFVASDEHSDEVLRDIV 391


>02_04_0437 -
           22938263-22938273,22938345-22938444,22938727-22938908,
           22938989-22939092,22939792-22939857,22940032-22940105,
           22940241-22940309,22940902-22941028,22941740-22942971,
           22943163-22943486,22943500-22943793
          Length = 860

 Score = 30.7 bits (66), Expect = 0.76
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = +1

Query: 295 QPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHAT 411
           QP    L+PE+  +VS   STI++N F L+ D   LHA+
Sbjct: 707 QPLRLDLSPEEEVIVSMNMSTIRKNGFVLAED---LHAS 742


>01_05_0564 +
           23312419-23312987,23314652-23314751,23314832-23315055,
           23315212-23316041,23316161-23316275,23316786-23316905,
           23317410-23317450,23317546-23317595,23317684-23317719,
           23317836-23317856
          Length = 701

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 11/23 (47%), Positives = 17/23 (73%)
 Frame = +1

Query: 289 AQQPPNTPLTPEQAQVVSELAST 357
           A++PP  PLTPE+A+  +E A +
Sbjct: 18  AEKPPAAPLTPEEAEAEAETAGS 40


>11_01_0228 + 1768318-1769871
          Length = 517

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +2

Query: 188 DLDKAITKFTNLNEHTDEVLQDIL 259
           D D  +++F   +EH+DEVL+DI+
Sbjct: 282 DRDDVLSRFVASDEHSDEVLRDIV 305


>02_05_1142 -
           34391144-34391590,34391715-34391904,34392058-34392128,
           34392403-34392515,34392656-34392749,34392843-34392908,
           34393120-34393282,34393441-34393547,34393918-34394115,
           34394204-34394329,34394800-34394904,34395056-34395098,
           34395334-34395391,34395479-34395659,34395751-34395917,
           34396010-34396249,34396341-34396781,34397147-34397272,
           34397457-34397561,34397935-34398002,34398169-34398272,
           34398856-34399008,34399472-34399570,34399919-34400046,
           34400149-34400300,34400423-34400502
          Length = 1274

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = +1

Query: 250 RYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAF 375
           R++ K ++ RR   +QP   P  PEQ Q   E A+ I+  +F
Sbjct: 439 RFLEKKKQQRRR--KQPKPKPKPPEQQQQQEEAAAAIQAPSF 478


>11_05_0023 -
           18447015-18447410,18448156-18448308,18448679-18449524,
           18449688-18449702
          Length = 469

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = -1

Query: 133 CFSKNDALLY*NKELRMTLPNILKRYVYSKN 41
           C    DAL Y +K+L    PNI K Y+ ++N
Sbjct: 256 CDGSPDALHYGSKKLPSIAPNIQKLYLSTRN 286


>10_06_0084 -
           10477880-10477897,10477940-10478002,10479523-10479575,
           10479774-10480589,10480889-10480998,10481338-10482068
          Length = 596

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 12/40 (30%), Positives = 20/40 (50%)
 Frame = -2

Query: 279 PQLLYFVNISCNTSSVCSFKFVNFVIALSKSCSTPIQESI 160
           P +L+  +  C   S+C+      + +LS  CST  +E I
Sbjct: 229 PTMLFVTSTFCTALSLCTQYLSEVLHSLSHLCSTSCEEKI 268


>06_03_1167 + 28111923-28113218
          Length = 431

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = +1

Query: 259 NKVEELRREIAQQPPNTPLTPEQAQVVSELASTIK 363
           N+ EE+R ++ + P N PL+P+    V+E+   I+
Sbjct: 349 NQNEEIRAKVIE-PSNDPLSPQTISKVAEMLPKIR 382


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,204,838
Number of Sequences: 37544
Number of extensions: 283141
Number of successful extensions: 739
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 731
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 739
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1178343540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).