SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0015
         (657 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_02_0207 + 13017538-13017670,13019486-13019658,13020754-130208...    31   0.61 
08_02_0386 - 16575636-16575698,16575799-16575858,16575947-165762...    29   2.5  
12_02_0356 + 17915029-17916236,17932970-17933283,17933936-179342...    28   5.7  
03_05_0337 - 23272845-23273271,23273318-23273526,23275615-23276298     27   9.9  

>06_02_0207 +
           13017538-13017670,13019486-13019658,13020754-13020845,
           13022213-13022271,13022659-13022759,13023907-13023988,
           13024092-13024321
          Length = 289

 Score = 31.5 bits (68), Expect = 0.61
 Identities = 15/41 (36%), Positives = 23/41 (56%)
 Frame = +3

Query: 249 AGATIHYLLLLANTRVFCCNQQLYY*SLDRRIILCAYLPSS 371
           A A+I+Y+L+  N R  CCN+ ++   L    ILC  +  S
Sbjct: 109 ANASINYVLIATNCRCLCCNRAIHS-MLQHTNILCVGIAMS 148


>08_02_0386 -
           16575636-16575698,16575799-16575858,16575947-16576239,
           16576361-16576517,16576601-16576948,16577047-16577177,
           16577417-16577882,16578425-16579132
          Length = 741

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = -3

Query: 649 PPIRIEV*SPSRPSSGGTAPHPWARAPKIPATSI 548
           PP+ +   SP  PS     P PW   P +P+TS+
Sbjct: 4   PPLHLFSPSPRPPSP---TPPPWLHGPHVPSTSV 34


>12_02_0356 +
           17915029-17916236,17932970-17933283,17933936-17934244,
           17934613-17935439
          Length = 885

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 4/51 (7%)
 Frame = +1

Query: 292 VCFAATSSSIINPSIVGSSYVLISLHQFVFMYEKLHL----SIICFTALKK 432
           +C  A  SS +  S+  S    +S H+ V M+E+LH      I+ F ALKK
Sbjct: 346 LCLMAKGSSKVT-SLSDSESDDVSYHELVSMFEELHAYSEKEIVKFKALKK 395


>03_05_0337 - 23272845-23273271,23273318-23273526,23275615-23276298
          Length = 439

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 15/32 (46%), Positives = 21/32 (65%)
 Frame = +3

Query: 558 AGILGALAQGWGAVPPLEGRLGLYTSILMGGP 653
           AG+LG+L    GA P LEGR+G+   + +G P
Sbjct: 134 AGLLGSLF-ALGAAPLLEGRVGVGFDLGLGLP 164


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,967,879
Number of Sequences: 37544
Number of extensions: 340550
Number of successful extensions: 818
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 796
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 818
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1644004708
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).