SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0014
         (593 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_05_0379 + 23628200-23628366,23629074-23629133,23630177-236302...    29   2.8  
12_01_0916 + 8959866-8959958,8960429-8960583,8960676-8961055,896...    28   6.5  
12_01_0911 + 8868557-8868664,8869415-8869420,8869774-8869928,887...    28   6.5  
05_07_0192 - 28314224-28316287                                         28   6.5  
02_05_0477 - 29339649-29340253,29340880-29341492                       28   6.5  
01_06_1355 + 36610390-36610479,36611906-36612063,36612144-366125...    27   8.5  

>03_05_0379 +
           23628200-23628366,23629074-23629133,23630177-23630209,
           23630253-23630665,23631522-23632008,23632623-23633334
          Length = 623

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 3/47 (6%)
 Frame = +3

Query: 414 LYECQGLVPERNL---IVRRLPSVSSSIL*RPVHEPDVCYKTIHRPI 545
           L E +  +PER +   + + +P++ +S+   P+H  DV +K IHRP+
Sbjct: 34  LVEEEAALPERPVDCWVSKAIPTILTSLK-NPIHA-DVMHKNIHRPL 78


>12_01_0916 +
           8959866-8959958,8960429-8960583,8960676-8961055,
           8961142-8962122,8962699-8962829
          Length = 579

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 3/21 (14%)
 Frame = -1

Query: 554 PWGYWPVYRFVAN---IWFMH 501
           P G W V RFVA+   +WFMH
Sbjct: 522 PTGGWAVIRFVADNPGVWFMH 542


>12_01_0911 +
           8868557-8868664,8869415-8869420,8869774-8869928,
           8870145-8871031,8871079-8871123,8872528-8872572,
           8873025-8873513,8873603-8873733
          Length = 621

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 3/21 (14%)
 Frame = -1

Query: 554 PWGYWPVYRFVAN---IWFMH 501
           P G W V RFVAN   +W+MH
Sbjct: 564 PTGGWAVIRFVANNPGMWYMH 584


>05_07_0192 - 28314224-28316287
          Length = 687

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 1/78 (1%)
 Frame = -1

Query: 569 TLRCSPWGYWPVYRFVANIWFMHGALED*GRN*RKPPDNQVPLGHQPLALV*GQVPHGVI 390
           T++   WG  PV   + N++   G++ED  R     P   V   +   +++ G   HG  
Sbjct: 341 TMKTGHWGLLPVCNALMNMYSKSGSVEDARRVFLSMPCRDVVSWN---SIIIGYAHHGRA 397

Query: 389 RSTTEV-HIRQFLERYPT 339
           R   E  H   F E  P+
Sbjct: 398 REAMEAFHDMLFAEEVPS 415


>02_05_0477 - 29339649-29340253,29340880-29341492
          Length = 405

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +3

Query: 423 CQGLVPERNLIVRRLPSVSSSIL*RPVHEPDVC 521
           C     ERN  V+RLP +S+++  + V E   C
Sbjct: 180 CDAPAKERNAAVKRLPEISAAVRAKVVLESGYC 212


>01_06_1355 + 36610390-36610479,36611906-36612063,36612144-36612523,
            36612600-36613583,36614228-36614292,36614946-36615024,
            36615480-36615529,36616595-36616781,36617922-36617957,
            36619226-36619348,36619466-36620386,36620506-36620636
          Length = 1067

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 3/25 (12%)
 Frame = -1

Query: 554  PWGYWPVYRFVAN---IWFMHGALE 489
            P G W V RFVAN   +WF H  L+
Sbjct: 1010 PTGGWAVIRFVANNPGMWFFHCHLD 1034


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,054,981
Number of Sequences: 37544
Number of extensions: 318715
Number of successful extensions: 675
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 667
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 675
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1411925004
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).