SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0013
         (573 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0466 - 34134138-34134278,34134355-34134481,34134558-341347...    99   1e-21
01_06_1253 - 35753546-35753686,35753759-35753885,35753970-357541...    99   1e-21
10_06_0053 - 10110617-10111271,10112023-10112417,10112565-101126...    75   5e-14
05_03_0026 + 7466017-7466034,7466340-7466405,7466572-7466833,746...    51   6e-07
11_06_0555 + 24947600-24947650,24947675-24947724,24948526-24948871     29   2.0  
02_04_0437 - 22938263-22938273,22938345-22938444,22938727-229389...    28   4.6  
01_01_0151 - 1346942-1347682                                           28   4.6  
04_03_0802 - 19830614-19831275,19831426-19831507                       28   6.1  
03_01_0309 - 2432395-2433271,2433494-2434495,2434538-2435073,243...    28   6.1  

>03_06_0466 -
           34134138-34134278,34134355-34134481,34134558-34134713,
           34135831-34135835
          Length = 142

 Score =   99 bits (238), Expect = 1e-21
 Identities = 46/52 (88%), Positives = 50/52 (96%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct: 91  NFIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142



 Score = 77.8 bits (183), Expect = 6e-15
 Identities = 33/42 (78%), Positives = 37/42 (88%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEK+G+EAKQPNSAIRKC RVQL+KNGKK+ AFVP DGC
Sbjct: 48  GIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGC 89


>01_06_1253 -
           35753546-35753686,35753759-35753885,35753970-35754125,
           35754761-35754853,35757132-35757265,35757339-35757465,
           35757550-35757705,35758321-35758325
          Length = 312

 Score =   99 bits (238), Expect = 1e-21
 Identities = 46/52 (88%), Positives = 50/52 (96%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct: 261 NFIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 312



 Score = 96.3 bits (229), Expect = 2e-20
 Identities = 44/50 (88%), Positives = 48/50 (96%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERP 104
           N IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+P
Sbjct: 91  NFIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 140



 Score = 77.8 bits (183), Expect = 6e-15
 Identities = 33/42 (78%), Positives = 37/42 (88%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEK+G+EAKQPNSAIRKC RVQL+KNGKK+ AFVP DGC
Sbjct: 48  GIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGC 89



 Score = 77.8 bits (183), Expect = 6e-15
 Identities = 33/42 (78%), Positives = 37/42 (88%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEK+G+EAKQPNSAIRKC RVQL+KNGKK+ AFVP DGC
Sbjct: 218 GIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGC 259


>10_06_0053 -
           10110617-10111271,10112023-10112417,10112565-10112650,
           10112973-10113021,10114164-10114290,10114372-10114526,
           10114730-10114948
          Length = 561

 Score = 74.5 bits (175), Expect = 5e-14
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEK+G+EAKQPNSAI KC RVQL+KNGKK+ AFVP DGC
Sbjct: 119 GIVLEKIGIEAKQPNSAICKCARVQLVKNGKKIAAFVPNDGC 160


>05_03_0026 +
           7466017-7466034,7466340-7466405,7466572-7466833,
           7467254-7467294
          Length = 128

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 22/27 (81%), Positives = 25/27 (92%)
 Frame = -3

Query: 235 DEVLVAGFGRKGHAVGDIPGVRFKVVK 155
           DEVL++GFG KGHAVGDI GVRF+VVK
Sbjct: 67  DEVLISGFGHKGHAVGDIRGVRFEVVK 93


>11_06_0555 + 24947600-24947650,24947675-24947724,24948526-24948871
          Length = 148

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 15/36 (41%), Positives = 19/36 (52%)
 Frame = +1

Query: 457 PWRYPT*SPCKHIPLSQRRNSRRGPAPIAPFQQVGA 564
           P  YPT SPC H P  +  + R G  P+ P+   GA
Sbjct: 114 PLLYPTRSPC-HRPPLRMASPRGGNFPVGPWDPPGA 148


>02_04_0437 -
           22938263-22938273,22938345-22938444,22938727-22938908,
           22938989-22939092,22939792-22939857,22940032-22940105,
           22940241-22940309,22940902-22941028,22941740-22942971,
           22943163-22943486,22943500-22943793
          Length = 860

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = -3

Query: 328 PQMRPCTAH*ERKESDRIRPP*RLPNHIEENDE 230
           PQ+RPC  H    E  R      L N++ +N+E
Sbjct: 601 PQLRPCDVHATESEVVRCYKAATLDNYVPDNEE 633


>01_01_0151 - 1346942-1347682
          Length = 246

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 8/77 (10%)
 Frame = -1

Query: 378 PPLEKVGVEAKQPNSAIRKCVRVQ-LIKNGKKV-----TAFVPRDGCQTTSKKTTKY*WR 217
           PPL +   E KQ ++A ++CV        G  V     +   P   C    + TTK  W+
Sbjct: 57  PPLYRCNDEVKQCSAACKECVEAPGDFPRGAFVCRDWYSTVDPGHMCTAPDQPTTKRPWK 116

Query: 216 --DSVVKVTPSVTFPEF 172
             DS+V++ P   FP F
Sbjct: 117 CCDSIVQL-PQRIFPPF 132


>04_03_0802 - 19830614-19831275,19831426-19831507
          Length = 247

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +1

Query: 457 PWRYPT*SPCKHIPLSQRRNSRRGPA 534
           P+  P   PCK  P  +RR++R GPA
Sbjct: 135 PYPVPYPVPCKCCPHRRRRHARSGPA 160


>03_01_0309 -
           2432395-2433271,2433494-2434495,2434538-2435073,
           2435579-2435716,2436050-2436148,2436278-2436346,
           2436968-2437063
          Length = 938

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 21/84 (25%), Positives = 33/84 (39%), Gaps = 5/84 (5%)
 Frame = +1

Query: 67  TAGHLSQCTPMILVAPFSLCRERGET----RWLLLPP*NELRECHRRRDLYDRIPPLVLR 234
           T GH+++  P+ L     LCR   E     + ++  P  E  E H+  DL   I  +   
Sbjct: 138 TTGHVAKAAPVFLDETIKLCRVYSEAAKSDQCIMSMPKEETTEEHKETDLTSNIAQITAC 197

Query: 235 RFLR-CGLATVTGDECGHFLSVLN 303
                C + T      G  + +LN
Sbjct: 198 TIQSLCKIGTHAASSGGSQVILLN 221


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,360,326
Number of Sequences: 37544
Number of extensions: 395398
Number of successful extensions: 1012
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 981
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1011
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1328870592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).