SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0012
         (588 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_06_0365 - 22582467-22583524,22584407-22584641,22585474-225856...    99   1e-21
08_02_1614 - 28243532-28244589,28245149-28245383,28245524-282457...    99   1e-21
03_04_0206 - 18493178-18495310                                         70   2e-12
02_05_1297 - 35536193-35536312,35536405-35536467,35536610-355369...    63   2e-10
04_04_1439 + 33614112-33614123,33614278-33615649,33615705-33616141     52   5e-07
04_01_0568 - 7279478-7279590,7279749-7279988,7280078-7280141,728...    39   0.003
01_06_0555 - 30182818-30183169,30183268-30183674,30183804-301847...    38   0.006
11_06_0325 + 22376195-22377001,22377136-22377525,22377638-223777...    37   0.010
08_02_1616 + 28260204-28262555                                         37   0.010
06_03_1249 - 28688997-28689248,28689469-28689533,28690016-286900...    34   0.073
08_01_0344 + 3043824-3044123,3044260-3044314,3044810-3044985,304...    33   0.22 
01_02_0042 - 10513799-10514152,10514252-10514545,10514630-105148...    33   0.22 
08_01_0345 + 3055522-3055827,3055968-3056022,3056744-3056919,305...    32   0.30 
06_01_0591 + 4261483-4261631,4261837-4262007,4262127-4262226,426...    32   0.30 
05_07_0003 + 26981956-26982190,26982258-26982318,26982739-269828...    32   0.30 
04_04_1331 - 32706043-32707248,32707411-32707652,32707737-327085...    32   0.30 
05_01_0271 + 2105122-2105470,2105557-2105954,2106035-2106273,210...    32   0.39 
01_06_0857 - 32507119-32507328,32507936-32508058,32508194-325082...    31   0.52 
11_08_0079 + 28189782-28189907,28190445-28190553,28190876-281909...    31   0.68 
07_03_0293 + 16321539-16321893,16322020-16322207,16322881-163229...    31   0.90 
04_04_0118 - 22889608-22890816,22891990-22892261,22892306-228931...    30   1.6  
02_02_0492 - 10907529-10907629,10907714-10907953,10908035-109080...    30   1.6  
05_07_0004 + 26990250-26990516,26990877-26990931,26991286-269914...    29   2.1  
02_02_0490 - 10879761-10879861,10879946-10880185,10880274-108803...    29   2.1  
01_07_0264 - 42388455-42388565,42388656-42388688,42388792-423889...    29   2.1  
01_06_0371 + 28819035-28819322,28820541-28820595,28821179-288213...    29   2.7  
01_06_0365 + 28767538-28767696,28768299-28768520,28768630-287688...    29   2.7  
04_04_1183 - 31537196-31537290,31537665-31537986,31538176-315382...    29   3.6  
04_04_0961 + 29715938-29716034,29716918-29717133,29717438-297177...    29   3.6  
03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838,235...    29   3.6  
02_01_0202 + 1366149-1366594,1368444-1368444,1368616-1368743,136...    29   3.6  
02_05_0621 - 30417044-30417196,30417511-30417586,30418055-304181...    28   4.8  
02_05_0385 - 28506326-28506891,28506993-28507405,28507496-285077...    28   4.8  
01_04_0053 - 15444421-15444747,15444905-15445116,15445198-154453...    28   4.8  
12_01_0227 - 1718726-1721183,1721804-1721957,1722090-1722165,172...    28   6.3  
11_01_0230 - 1788199-1789746                                           28   6.3  
08_02_1457 + 27260841-27260965,27261126-27261246,27263455-272635...    28   6.3  
06_03_0473 + 21190878-21191188,21191269-21192355,21192972-211931...    28   6.3  
04_04_0271 + 24069218-24069433,24069695-24070365,24070458-24073410     28   6.3  
02_03_0235 - 16702768-16702956,16703956-16704492,16705084-167052...    28   6.3  
02_01_0672 - 4989053-4990432,4990523-4991410,4995896-4996436,499...    28   6.3  
02_01_0670 - 4976658-4978037,4978128-4979015,4982590-4983130,498...    28   6.3  
02_02_0682 - 12923103-12923747,12924607-12924870,12924953-129252...    27   8.4  

>09_06_0365 -
           22582467-22583524,22584407-22584641,22585474-22585684,
           22585775-22585848,22585943-22586092
          Length = 575

 Score =   99 bits (238), Expect = 1e-21
 Identities = 46/68 (67%), Positives = 55/68 (80%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P SRDI I + S+TF+G +LL DT LELN GRRYGL+GLNGCGKS LL A+  RE+PIP 
Sbjct: 44  PLSRDIHIESLSLTFHGHDLLLDTDLELNYGRRYGLLGLNGCGKSCLLKAIGCRELPIPP 103

Query: 431 HIDIFHLT 454
           H+DI+HLT
Sbjct: 104 HMDIYHLT 111


>08_02_1614 -
           28243532-28244589,28245149-28245383,28245524-28245734,
           28245834-28245907,28246465-28246665
          Length = 592

 Score =   99 bits (238), Expect = 1e-21
 Identities = 44/68 (64%), Positives = 57/68 (83%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P SRDI I + S+TF+G +L+ D+ LELN GRRYGL+GLNGCGKS+LL A+  RE+PIPE
Sbjct: 61  PLSRDIHIESLSLTFHGHDLIVDSELELNYGRRYGLLGLNGCGKSTLLTAIGCRELPIPE 120

Query: 431 HIDIFHLT 454
           H+DI+HL+
Sbjct: 121 HMDIYHLS 128


>03_04_0206 - 18493178-18495310
          Length = 710

 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 32/61 (52%), Positives = 44/61 (72%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHID 439
           +DI + NFS++  G ELL++  L ++ GRRYGLVG NG GKS+LL  L  R+VP+P  ID
Sbjct: 156 KDIVLENFSVSARGKELLKNASLRISHGRRYGLVGPNGMGKSTLLKLLSWRQVPVPRSID 215

Query: 440 I 442
           +
Sbjct: 216 V 216


>02_05_1297 -
           35536193-35536312,35536405-35536467,35536610-35536942,
           35537098-35537184,35538337-35538399,35538604-35538750,
           35538900-35539001,35539069-35539197,35539506-35539664,
           35539726-35539967,35540317-35540506,35540692-35540907,
           35541536-35541760
          Length = 691

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 1/68 (1%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-IP 427
           P  RDI + NFS+T  G +L+QD  + L  GR YGLVG NG GK+S L A+    +  IP
Sbjct: 177 PAVRDIHMENFSVTVGGRDLIQDCTVTLAFGRHYGLVGRNGTGKTSFLRAMAMHAIDGIP 236

Query: 428 EHIDIFHL 451
           ++  I H+
Sbjct: 237 KNCQILHV 244


>04_04_1439 + 33614112-33614123,33614278-33615649,33615705-33616141
          Length = 606

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 26/77 (33%), Positives = 42/77 (54%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHID 439
           RD+ + +  +   G  L +   L +  GRRYGLVG NG GK++LL  L  R++P+P  I 
Sbjct: 87  RDVVVEDSDVWVQGVALFEGASLRVAHGRRYGLVGPNGKGKTTLLKLLHWRKLPVPRGIR 146

Query: 440 IFHLTRGGARYPIRPIV 490
           +  + +       RP++
Sbjct: 147 VTLVVQEDDNRDPRPVI 163



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +2

Query: 329 ELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           +++ G+R  +VG NG GKS+LL  L     P
Sbjct: 397 DVSMGQRVAVVGPNGAGKSTLLKLLAGELTP 427


>04_01_0568 - 7279478-7279590,7279749-7279988,7280078-7280141,
            7280242-7280547,7280643-7280857,7281395-7281689,
            7281906-7281983,7282070-7282705,7283016-7283102,
            7283945-7284265,7285503-7287599
          Length = 1483

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            P   DI + +  + +  +   +L+   + +N G + G+VG  G GKS+L+ AL R   P+
Sbjct: 1232 PRRGDIDVKDLKVRYRSNTPLILKGITISINSGEKIGVVGRTGSGKSTLVQALFRLVEPV 1291

Query: 425  PEHI 436
              HI
Sbjct: 1292 EGHI 1295


>01_06_0555 - 30182818-30183169,30183268-30183674,30183804-30184773,
            30184829-30184902,30184941-30185084,30185186-30185365,
            30185448-30185988,30186081-30186538,30187723-30187901,
            30187998-30188052,30188217-30188468
          Length = 1203

 Score = 37.9 bits (84), Expect = 0.006
 Identities = 15/34 (44%), Positives = 24/34 (70%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            +LQD  L++  G   GLVG +GCGKS+++  ++R
Sbjct: 982  ILQDFSLDVKAGTSIGLVGRSGCGKSTIIGLIQR 1015



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 13/34 (38%), Positives = 23/34 (67%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           +L+D  L++  G+   LVG +G GKS+ +A ++R
Sbjct: 381 VLKDFNLQIPAGQTVALVGSSGSGKSTAIALVQR 414


>11_06_0325 +
           22376195-22377001,22377136-22377525,22377638-22377778,
           22377888-22378067,22378268-22378447,22378536-22378637,
           22378768-22378896,22379318-22379422,22379528-22379623
          Length = 709

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 17/61 (27%), Positives = 33/61 (54%)
 Frame = +2

Query: 239 TGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           +G +     +++   + ++ G  +L+D   E+  G + GLVG+NG GK++ L  +   E 
Sbjct: 82  SGASSIPTGVRLEGIAKSYKGVTVLRDVSWEVQRGEKVGLVGVNGAGKTTQLRIIAGLED 141

Query: 419 P 421
           P
Sbjct: 142 P 142



 Score = 32.7 bits (71), Expect = 0.22
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           + I N    F   +L  +  L +  G +  ++G NGCGKS+LL
Sbjct: 434 LTIRNLEFGFGEEKLFNNANLIVERGEKIAIIGPNGCGKSTLL 476


>08_02_1616 + 28260204-28262555
          Length = 783

 Score = 37.1 bits (82), Expect = 0.010
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           ++ +D  L    GR   LVG +GCGKSS+LA ++R
Sbjct: 539 QVFRDLSLRARAGRTLALVGASGCGKSSVLALVQR 573


>06_03_1249 -
           28688997-28689248,28689469-28689533,28690016-28690093,
           28691480-28691824,28693314-28693510,28695601-28696601
          Length = 645

 Score = 34.3 bits (75), Expect = 0.073
 Identities = 18/43 (41%), Positives = 26/43 (60%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIP 427
           G E+L+   L++  G   G++G +G GKS+LL AL R   P P
Sbjct: 439 GEEILRGVDLDVPRGVVVGVIGPSGSGKSTLLRALNRLWEPAP 481


>08_01_0344 +
           3043824-3044123,3044260-3044314,3044810-3044985,
           3045083-3045283,3045383-3045642,3045909-3046222,
           3046399-3046622,3047046-3047398,3047709-3047826,
           3047875-3048133,3048252-3049729
          Length = 1245

 Score = 32.7 bits (71), Expect = 0.22
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           +LQ   L +  G+   LVG +GCGKS++++ L+R
Sbjct: 396 ILQGFSLSIPAGKVVALVGSSGCGKSTVISLLQR 429



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            +L    L +  G+R  LVG +G GKSS+LA L R
Sbjct: 1011 ILDGFSLVIEPGQRVALVGPSGAGKSSVLALLLR 1044


>01_02_0042 - 10513799-10514152,10514252-10514545,10514630-10514893,
            10515019-10515285,10515363-10516207,10516311-10516584,
            10516694-10517219,10518009-10518247,10518370-10518591,
            10518689-10518864,10518962-10519358
          Length = 1285

 Score = 32.7 bits (71), Expect = 0.22
 Identities = 16/44 (36%), Positives = 26/44 (59%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
            E+ +D  L ++ G+   LVG +G GKS+ ++ L+R   P   HI
Sbjct: 1057 EIFRDLCLTIHSGKTVALVGESGSGKSTAISLLQRFYDPDVGHI 1100


>08_01_0345 +
           3055522-3055827,3055968-3056022,3056744-3056919,
           3057104-3057232,3057313-3057572,3057688-3058001,
           3058268-3058491,3058862-3059214,3059489-3059916,
           3060031-3061514
          Length = 1242

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 15/43 (34%), Positives = 27/43 (62%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           +L+   L +  G+   LVG +GCGKS++++ ++R   PI  +I
Sbjct: 374 ILRSFSLSIPAGKVVALVGSSGCGKSTVISLVQRFYDPISGNI 416



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            +L    L +  G+R  LVG +G GKS++++ L R
Sbjct: 1006 ILDGFSLAIEPGQRVALVGPSGAGKSTIVSLLLR 1039


>06_01_0591 +
           4261483-4261631,4261837-4262007,4262127-4262226,
           4263151-4263315,4263416-4263544,4263758-4263858,
           4264527-4264596,4265080-4265331,4265828-4265897,
           4266281-4266341,4266916-4267003,4267746-4267830,
           4268168-4268234,4268442-4268559,4268843-4268923,
           4269022-4269267,4269670-4269771,4269847-4269914,
           4270040-4270171,4270283-4270430,4270504-4270790,
           4270920-4271067,4271156-4271331,4271407-4271518,
           4271614-4271667,4273134-4273244,4273317-4273478,
           4273627-4273814,4273948-4274137,4274297-4274464,
           4274832-4274912
          Length = 1359

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +2

Query: 302 SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           S +L+D  LEL  G    ++G  GCGKSSLL ++
Sbjct: 630 SMILRDVSLELQKGIFVAIIGEVGCGKSSLLNSI 663



 Score = 31.1 bits (67), Expect = 0.68
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +2

Query: 311  LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            L D    ++ G + G++G  G GKSS+L AL R
Sbjct: 1139 LNDVSFFISSGMQVGIIGRTGAGKSSILNALLR 1171


>05_07_0003 + 26981956-26982190,26982258-26982318,26982739-26982833,
            26983304-26983479,26983738-26983959,26984041-26984279,
            26984786-26985311,26985407-26985680,26985759-26986410,
            26986508-26986736,26986841-26987107,26987180-26987443,
            26987526-26988194
          Length = 1302

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/35 (37%), Positives = 23/35 (65%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++ ++  L +  G+   LVG +GCGKS+++A L R
Sbjct: 1067 QIFRNLSLRIPSGKMVALVGESGCGKSTVIALLER 1101


>04_04_1331 - 32706043-32707248,32707411-32707652,32707737-32708562,
            32708640-32708863,32708946-32709262,32709381-32709443,
            32709465-32709640,32710609-32710985,32711416-32711470,
            32711614-32711913
          Length = 1261

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/35 (37%), Positives = 23/35 (65%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++ +D  L++  GR   LVG +G GKS+++A + R
Sbjct: 1036 QIFKDFNLKIQAGRSQALVGASGSGKSTVIALIER 1070


>05_01_0271 + 2105122-2105470,2105557-2105954,2106035-2106273,
            2107120-2107645,2107817-2108090,2108197-2109056,
            2109201-2109467,2109711-2109974,2110063-2110356,
            2110455-2110814
          Length = 1276

 Score = 31.9 bits (69), Expect = 0.39
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
            ++ +D  L +  G+   LVG +G GKS+ ++ L+R   P   HI
Sbjct: 1046 QIFEDLCLTIQSGKTVALVGESGSGKSTAISLLQRFYDPDAGHI 1089


>01_06_0857 -
           32507119-32507328,32507936-32508058,32508194-32508262,
           32509963-32510238
          Length = 225

 Score = 31.5 bits (68), Expect = 0.52
 Identities = 28/90 (31%), Positives = 42/90 (46%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFHLTRGGARYPIRPI 487
           +L+D  L +  G+ + L+G NGCGKS+LL  +    +P  E    F L +       RPI
Sbjct: 63  VLKDCSLRVPPGQLWMLLGPNGCGKSTLLKVV----MPTVESDVAFGLGKLNLSLDERPI 118

Query: 488 VSRITIHGRRFTNVVTGKTLAFPNLIALQD 577
               T+ G +   V     LA  + + L D
Sbjct: 119 Q---TLSGGQKQRVAIAGALAEASKVLLLD 145


>11_08_0079 +
           28189782-28189907,28190445-28190553,28190876-28190958,
           28191500-28191562,28191658-28192854,28193247-28193310,
           28193338-28193426,28194404-28194463,28195442-28195547,
           28196057-28196069,28196940-28197111
          Length = 693

 Score = 31.1 bits (67), Expect = 0.68
 Identities = 20/58 (34%), Positives = 32/58 (55%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEH 433
           ++ ++A+ S    G+E     +LEL      GLVG+   GKS+LL+AL R    I ++
Sbjct: 314 KEEEMASLSTGHPGTETY--LILELKSIADVGLVGMPNAGKSTLLSALSRARPEIADY 369


>07_03_0293 +
           16321539-16321893,16322020-16322207,16322881-16322904,
           16323497-16323550,16323854-16323944,16324715-16324815,
           16324949-16324999,16326626-16326754,16327772-16327834,
           16327928-16328171,16329628-16329776,16329855-16329944,
           16330343-16330477,16330579-16330635,16331079-16331135,
           16332299-16332336,16332532-16332601,16332971-16333207
          Length = 710

 Score = 30.7 bits (66), Expect = 0.90
 Identities = 16/46 (34%), Positives = 24/46 (52%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           E+L    L + CG+   LVG +G GKS+++  L R   P    I +
Sbjct: 446 EILNGLDLTIECGKITALVGPSGAGKSTVVQLLARYYEPTHGRITV 491


>04_04_0118 - 22889608-22890816,22891990-22892261,22892306-22893131,
            22893311-22893534,22893620-22893936,22894035-22894294,
            22894723-22894923,22895015-22895190,22895445-22895718
          Length = 1252

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 13/39 (33%), Positives = 23/39 (58%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            + +D  L +  G+   LVG +G GKS+++A + R   P+
Sbjct: 1027 VFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPL 1065


>02_02_0492 - 10907529-10907629,10907714-10907953,10908035-10908098,
            10908416-10908721,10909347-10909561,10909656-10909950,
            10910493-10910597,10911112-10911180,10911433-10911519,
            10911953-10913704,10914964-10915054,10915217-10915488
          Length = 1198

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSEL---LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P + +I++ N  +  Y ++L   L+     L  G R G+VG  G GKS+L+ AL R
Sbjct: 951  PTNGEIELRNLHVR-YATQLPFVLKGLTCTLPRGLRTGIVGRTGNGKSTLIQALFR 1005


>05_07_0004 + 26990250-26990516,26990877-26990931,26991286-26991461,
            26991702-26991923,26992001-26992239,26992437-26992962,
            26993042-26993315,26993391-26994009,26994082-26994121,
            26994263-26994310,26994548-26994814,26994892-26995155,
            26995260-26995904
          Length = 1213

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  D  L +  G+   LVG +G GKS+ +A L R
Sbjct: 986  QIFSDFTLSIPSGKTVALVGQSGSGKSTAIALLER 1020


>02_02_0490 - 10879761-10879861,10879946-10880185,10880274-10880337,
            10880426-10880731,10881098-10881312,10881417-10881711,
            10882193-10882357,10882477-10882527,10882657-10883109,
            10883195-10883281,10883736-10884800,10884858-10885376
          Length = 1186

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSEL---LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P + +I++ N  +  Y ++L   L+     L  G + G+VG  G GKS+L+ AL R
Sbjct: 939  PTNGEIELRNLHVR-YATQLPFVLKGLTCTLPGGLKTGIVGRTGSGKSTLIQALFR 993


>01_07_0264 -
           42388455-42388565,42388656-42388688,42388792-42388905,
           42389011-42389100,42389173-42389268,42389363-42389404,
           42389498-42389608,42392258-42392440,42392518-42392961
          Length = 407

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 15/32 (46%), Positives = 17/32 (53%)
 Frame = +3

Query: 210 NSEARSCTGSLAVHPVLEISR*LTFQLLSMGV 305
           N  A +CT   AVH VLE S   T   + MGV
Sbjct: 40  NENAHACTSLTAVHQVLEESTNNTVHAMDMGV 71


>01_06_0371 + 28819035-28819322,28820541-28820595,28821179-28821354,
            28821481-28821702,28821796-28822034,28822107-28822632,
            28822726-28822999,28823098-28823737,28823833-28824061,
            28824299-28824565,28824700-28824963,28825045-28825689
          Length = 1274

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  D  L +  G+   LVG +G GKS+ +A L R
Sbjct: 1047 QIFSDFTLHIPSGKTVALVGESGSGKSTAIALLER 1081


>01_06_0365 + 28767538-28767696,28768299-28768520,28768630-28768868,
            28769499-28770024,28770115-28770388,28770495-28771134,
            28771220-28771448,28771682-28771948,28772031-28772294,
            28772700-28773344
          Length = 1154

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++L D  L +  G+   LVG +G GKS+++A L R
Sbjct: 927  QVLCDFTLGIPSGKTVALVGESGSGKSTVIALLER 961


>04_04_1183 - 31537196-31537290,31537665-31537986,31538176-31538277,
            31538826-31539071,31539385-31539506,31539588-31540344,
            31540447-31540770,31540872-31541052,31541208-31541602,
            31541877-31541942,31542225-31542377,31542593-31542691,
            31542776-31542982,31543432-31543572,31543852-31544019,
            31544302-31544395,31544479-31544585,31545140-31545274,
            31545549-31545656,31545975-31546049,31546197-31546262,
            31546500-31546556,31546678-31546702,31546809-31546889,
            31546966-31547080,31547211-31547370,31547444-31547483,
            31547599-31547780,31547905-31548234
          Length = 1650

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 13/26 (50%), Positives = 17/26 (65%)
 Frame = +2

Query: 332  LNCGRRYGLVGLNGCGKSSLLAALRR 409
            +N   + G+VG  G GKSS+L AL R
Sbjct: 1291 INGSEKVGIVGRTGAGKSSMLNALFR 1316


>04_04_0961 +
           29715938-29716034,29716918-29717133,29717438-29717776,
           29718247-29719274,29719465-29719551,29719636-29720043,
           29720394-29720558,29720742-29721036,29721131-29721345,
           29721838-29722143,29722474-29722537,29722644-29722883,
           29722959-29723062
          Length = 1187

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 13/34 (38%), Positives = 22/34 (64%)
 Frame = +2

Query: 302 SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           S  L+D  L++  G +  + G+ G GKSSLL+++
Sbjct: 410 SPTLKDVELKVKRGMKVAICGMVGSGKSSLLSSI 443



 Score = 28.7 bits (61), Expect = 3.6
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 4/68 (5%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSELLQDTLLELNC---GRR-YGLVGLNGCGKSSLLAALRRREV 418
            P   +I I    + +  +E L   L  ++C   GR+  G+VG  G GKS+L+ AL R   
Sbjct: 939  PLDGNINIRCLEVRY--AEHLPSVLRNISCTIPGRKKVGIVGRTGSGKSTLIQALFRIVE 996

Query: 419  PIPEHIDI 442
            P    I+I
Sbjct: 997  PREGTIEI 1004


>03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838,
            2353031-2353708,2353800-2353964,2354139-2354433,
            2354581-2354795,2354885-2355190,2355269-2355332,
            2355426-2355665,2355783-2355886
          Length = 1505

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 12/23 (52%), Positives = 17/23 (73%)
 Frame = +2

Query: 341  GRRYGLVGLNGCGKSSLLAALRR 409
            G++ G+VG  G GKS+L+ AL R
Sbjct: 1289 GKKIGIVGRTGSGKSTLIQALFR 1311


>02_01_0202 +
           1366149-1366594,1368444-1368444,1368616-1368743,
           1368943-1369039
          Length = 223

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +2

Query: 353 GLVGLNGCGKSSLLAALRRREVPIP 427
           GL+G +G G++     LRRR VP+P
Sbjct: 17  GLLGDSGGGEAPAAEVLRRRRVPVP 41


>02_05_0621 -
           30417044-30417196,30417511-30417586,30418055-30418157,
           30418269-30418339,30418446-30418789,30419867-30420004,
           30420089-30420151,30420392-30420489,30421049-30421179,
           30422397-30422428
          Length = 402

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 16/62 (25%), Positives = 26/62 (41%)
 Frame = +2

Query: 341 GRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFHLTRGGARYPIRPIVSRITIHGRRF 520
           G+ YGL+G  G GK  LLA   R    + +        R  +R  +   ++   + G   
Sbjct: 297 GKGYGLLGQAGSGKLRLLAGQSRLAAKVAKRFKARSCDRSESRSGLTSTLAFTPVQGMEL 356

Query: 521 TN 526
           +N
Sbjct: 357 SN 358


>02_05_0385 - 28506326-28506891,28506993-28507405,28507496-28507743,
            28507820-28508480,28508572-28509498,28509588-28509847,
            28509943-28510143,28515547-28515633,28516200-28516375,
            28516465-28516519,28516623-28516910
          Length = 1293

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 326  LELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            L +  G+   LVG++G GKS++L+ + R   PI
Sbjct: 1066 LLMKAGKSMALVGMSGSGKSTVLSLILRFYDPI 1098


>01_04_0053 -
           15444421-15444747,15444905-15445116,15445198-15445377,
           15445572-15445836,15446308-15446522,15446611-15446784,
           15446872-15447010,15447523-15447786
          Length = 591

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +2

Query: 329 ELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           EL      G+VGL   GKSSL+ +L+R  V
Sbjct: 264 ELKLAITVGIVGLPNVGKSSLINSLKRSRV 293


>12_01_0227 -
           1718726-1721183,1721804-1721957,1722090-1722165,
           1722327-1722485,1722552-1722662,1722791-1722841,
           1722948-1723192,1723745-1725278
          Length = 1595

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/36 (44%), Positives = 18/36 (50%)
 Frame = -1

Query: 492 LTIGRIGYRAPPRVRWNMSMCSGIGTSRRLKAASND 385
           L IGR  +  P  V W +     IGT RRLK A  D
Sbjct: 227 LVIGR--FMDPIEVSWKIKKWLNIGTERRLKKAIAD 260


>11_01_0230 - 1788199-1789746
          Length = 515

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/36 (44%), Positives = 18/36 (50%)
 Frame = -1

Query: 492 LTIGRIGYRAPPRVRWNMSMCSGIGTSRRLKAASND 385
           L IGR  +  P  V W +     IGT RRLK A  D
Sbjct: 227 LVIGR--FMDPIEVSWKIKKWLNIGTERRLKKAIAD 260


>08_02_1457 +
           27260841-27260965,27261126-27261246,27263455-27263543,
           27263776-27263860,27263970-27264074,27264446-27264527,
           27264573-27264686,27265029-27265330,27265519-27266114,
           27266216-27266376,27266489-27266592,27266697-27266856,
           27266942-27267105,27267213-27267545,27267640-27267930,
           27268276-27268359,27268430-27268563,27268665-27268892,
           27268993-27269164,27269263-27269517,27269778-27270047
          Length = 1324

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = +2

Query: 269 KIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           ++  + +T    +LLQD       G    L+G+ G GK++LL  L  R+
Sbjct: 737 EMTKYGVTDKKLQLLQDVSGAFRPGVLTALMGITGAGKTTLLDVLAGRK 785


>06_03_0473 +
           21190878-21191188,21191269-21192355,21192972-21193194,
           21193286-21193356,21193385-21193441,21193442-21194056,
           21194168-21194237,21194470-21194745,21194916-21195130,
           21195224-21195529,21195750-21195813,21195902-21196141,
           21196306-21196415
          Length = 1214

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 3/49 (6%)
 Frame = +2

Query: 266 IKIANFSITFYGSEL---LQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           I + + S ++ GSE    L++  L +  G +  + G  G GKSSLL AL
Sbjct: 408 IHVQDGSFSWSGSEAELTLKNAHLSIRRGEKVAVCGPVGSGKSSLLCAL 456


>04_04_0271 + 24069218-24069433,24069695-24070365,24070458-24073410
          Length = 1279

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 11/28 (39%), Positives = 18/28 (64%)
 Frame = +2

Query: 326  LELNCGRRYGLVGLNGCGKSSLLAALRR 409
            LE+  G+   LVG +G GKS+++  + R
Sbjct: 1051 LEIGAGKTVALVGPSGSGKSTVIGLIER 1078


>02_03_0235 -
           16702768-16702956,16703956-16704492,16705084-16705233,
           16705310-16705625,16707005-16707286,16707895-16707971,
           16708121-16708186,16708700-16709246,16709435-16709565,
           16709642-16709746,16709859-16710039,16710123-16710185,
           16711000-16711109,16711576-16711638,16711859-16712191
          Length = 1049

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 13/20 (65%), Positives = 15/20 (75%)
 Frame = +2

Query: 344 RRYGLVGLNGCGKSSLLAAL 403
           RR  L+GL G GK+SLL AL
Sbjct: 750 RRVRLLGLEGAGKTSLLKAL 769


>02_01_0672 -
           4989053-4990432,4990523-4991410,4995896-4996436,
           4996532-4997168,4997266-4997320,4997439-4997675
          Length = 1245

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRR 409
           L +  GR   LVG +G GKS+++A L R
Sbjct: 382 LRVPAGRTVALVGGSGSGKSTVIALLER 409


>02_01_0670 -
           4976658-4978037,4978128-4979015,4982590-4983130,
           4983209-4983845,4983962-4983992,4984094-4984324
          Length = 1235

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRR 409
           L +  GR   LVG +G GKS+++A L R
Sbjct: 372 LRVPAGRTVALVGGSGSGKSTVIALLER 399


>02_02_0682 - 12923103-12923747,12924607-12924870,12924953-12925219,
            12925301-12925529,12925614-12926295,12926409-12926682,
            12926822-12927347,12927460-12927698,12927799-12927896,
            12928017-12928020,12928657-12928832,12929593-12929647,
            12930787-12931047
          Length = 1239

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  +  L +  G+   LVG +G GKS+++A L R
Sbjct: 1012 QIFTNLCLRIPSGKTVALVGESGSGKSTVVALLER 1046


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,968,434
Number of Sequences: 37544
Number of extensions: 330138
Number of successful extensions: 858
Number of sequences better than 10.0: 43
Number of HSP's better than 10.0 without gapping: 806
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 857
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1388195172
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).