SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0009
         (606 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_06_0734 - 26774471-26774652,26775008-26775137,26775447-267755...    31   0.94 
09_02_0566 + 10732359-10732497,10733114-10733267,10733448-107335...    29   2.9  
01_01_1026 - 8124929-8125120,8125294-8125344,8125610-8125743,812...    28   5.0  

>11_06_0734 -
           26774471-26774652,26775008-26775137,26775447-26775596,
           26775685-26775918,26775990-26776161,26776285-26776506,
           26776604-26776770,26776880-26777018,26777342-26777693,
           26778175-26778370
          Length = 647

 Score = 30.7 bits (66), Expect = 0.94
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +1

Query: 385 ISEFRLAMPWARIIERIKFENVKSSMRFMVFEQ 483
           IS FR+ + WAR++     E +KSS+ F   E+
Sbjct: 205 ISVFRMGVDWARLMPEEPTEELKSSVNFAALER 237


>09_02_0566 +
           10732359-10732497,10733114-10733267,10733448-10733519,
           10733701-10733769,10734430-10734501,10734590-10734661,
           10734769-10734840,10734928-10734999,10735121-10735192,
           10735293-10735364,10735435-10735506,10735826-10735897,
           10736039-10736104,10736638-10736676,10736787-10736845,
           10737166-10737545,10737629-10737824,10738012-10738179,
           10738618-10738736,10738873-10739083,10739163-10739403,
           10739830-10739980,10740469-10740828
          Length = 999

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 15/47 (31%), Positives = 27/47 (57%)
 Frame = -3

Query: 577 RSMFYGIAKARIYLEWPGLR*KCLSILRPVPFVRKP*NAYSILHFQI 437
           R++F  + + R+ L+WP  R  CL I R + ++ +  +A  I+H  I
Sbjct: 746 RALFGTVEQYRLSLDWPTRRKICLGIARGLAYLHEE-SAIRIVHRDI 791


>01_01_1026 -
           8124929-8125120,8125294-8125344,8125610-8125743,
           8125842-8126096,8126175-8126513,8126607-8126748,
           8127068-8127199
          Length = 414

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 10/27 (37%), Positives = 19/27 (70%)
 Frame = -1

Query: 138 LSMPFINLSPPYPTRWGRHSEFFYSIL 58
           +++P I++  P P  WG+ + FF++IL
Sbjct: 1   MTLPAIHMIQPVPIDWGQCTFFFHAIL 27


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,795,672
Number of Sequences: 37544
Number of extensions: 370175
Number of successful extensions: 919
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 900
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 919
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1442939384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).