SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0008
         (564 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_1554 + 34372480-34372587,34372692-34372871,34372985-343730...    29   3.4  
01_01_0095 + 733307-734060,734779-734802,735029-736098                 28   4.5  
04_04_1323 + 32644956-32645096,32645488-32646126,32646701-326469...    27   7.8  

>04_04_1554 +
           34372480-34372587,34372692-34372871,34372985-34373032,
           34374061-34374117,34374206-34374307,34374434-34374499,
           34374973-34375074,34375116-34375205
          Length = 250

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = -3

Query: 259 ILLCTGTSGLTIFGRLIVGNRHLKTSLESISDI*SVP 149
           +L C+   G T F R +  + H+ TSL+ IS + SVP
Sbjct: 188 VLFCSSEVGRTSFVRQLEADFHIDTSLDIISQL-SVP 223


>01_01_0095 + 733307-734060,734779-734802,735029-736098
          Length = 615

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = -3

Query: 466 YRKCRCELYRSSPGSRCLLASFVQIPSASGTKD 368
           Y   RC LY + PG + +  S V  PS S T D
Sbjct: 106 YHSSRCSLYNAQPG-KIVCCSKVLTPSMSPTND 137


>04_04_1323 +
           32644956-32645096,32645488-32646126,32646701-32646907,
           32647020-32647100,32647686-32648566,32648641-32648932,
           32649657-32650673,32651334-32651605,32651992-32652493
          Length = 1343

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 14/46 (30%), Positives = 21/46 (45%)
 Frame = -1

Query: 186 LRLSRFPTFNPFHLYFILKVFHSYCCNFIKKTCIFYFVSCFIYIFS 49
           ++ S+FP   PF  Y    +F S   N  K   + Y V C +  F+
Sbjct: 480 IKNSKFPPAEPFDDYIAKYLFPSISGNRNKALFLGYMVKCLLMAFT 525


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,464,760
Number of Sequences: 37544
Number of extensions: 255269
Number of successful extensions: 457
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 452
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 457
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1293275844
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).