SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0007
         (555 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_04_0268 - 19574540-19574582,19574664-19574755,19574843-195749...    31   0.62 
06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,890...    30   1.4  

>05_04_0268 -
           19574540-19574582,19574664-19574755,19574843-19574920,
           19575095-19575232,19575478-19575606,19575889-19576018,
           19576171-19576348,19576715-19576853,19577031-19577120,
           19577260-19577421,19577556-19577720,19577909-19578046,
           19578657-19578836,19579129-19579257,19579442-19579677,
           19579795-19579957,19580030-19580070,19580162-19580489,
           19581416-19581553,19581670-19581873
          Length = 966

 Score = 31.1 bits (67), Expect = 0.62
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 2/58 (3%)
 Frame = -2

Query: 449 QNPLEILKTCRVTHMTFLSQKLF--LRVALKVHKQYLKTSVLHKTLPYQPSFYPELYR 282
           QN  E +  CR  HM F S +    +R  +      L+   L + LPYQ S +  ++R
Sbjct: 644 QNGAEGIGLCRTEHMFFASDERIKAVRQMIMASSLELRQKALDRLLPYQRSDFEGIFR 701


>06_01_1087 +
           8901950-8902102,8902960-8903996,8904438-8904586,
           8905437-8905690,8905785-8908799,8908889-8909001,
           8909975-8910164,8910399-8910512,8910591-8910698,
           8910941-8911073,8911206-8911408,8911626-8911826
          Length = 1889

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 13/40 (32%), Positives = 23/40 (57%)
 Frame = -2

Query: 182 VYVIQQNIFILNVFTCNTTRI*FENLKLLKFTGASCAPVG 63
           +Y+++     LN  TC+ +R  F +LK+   TG++C   G
Sbjct: 774 IYLVRPVNDELNARTCSLSRQTFSSLKIFSVTGSNCHETG 813


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,618,168
Number of Sequences: 37544
Number of extensions: 223433
Number of successful extensions: 384
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 375
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 384
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1257681096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).