SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0006
         (600 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585...   134   4e-32
03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731...   132   2e-31
01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054...   132   2e-31
11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306...   131   4e-31
10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910...   131   4e-31
05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32...   131   4e-31
03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137...   131   4e-31
01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782...   131   4e-31
12_02_1282 + 27528159-27529148,27529549-27529614                      130   6e-31
12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323...   130   8e-31
08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981...    55   5e-08
08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207...    52   4e-07
01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238...    42   5e-04
08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160...    41   7e-04
01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931...    40   0.002
02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980...    39   0.003
04_03_0738 + 19169764-19169897,19169987-19170116,19170614-191706...    31   0.53 
03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093     31   0.70 
06_01_0824 - 6219477-6219556,6220427-6220808,6221415-6221448,622...    30   1.2  
03_05_0520 + 25139314-25139364,25139580-25139711,25141594-251417...    30   1.6  
07_03_1713 + 28939446-28939574,28939674-28940231,28940338-289404...    29   2.8  
07_03_0401 + 17724103-17724463,17724554-17724683,17725068-177250...    29   2.8  
07_03_0143 - 14315097-14315130,14315594-14315662,14316152-143162...    29   2.8  
05_04_0299 - 19958776-19958858,19958883-19959012,19960131-199601...    29   3.8  
03_05_0812 + 27890030-27890219,27890618-27890916,27891603-278918...    29   3.8  
03_01_0470 + 3619417-3619572,3619681-3619759,3620017-3620258,362...    29   3.8  
12_01_0386 + 3023431-3023522,3023951-3024097,3024227-3024308,302...    28   5.0  
03_05_1068 + 30114682-30114868,30114947-30115239,30115354-301155...    28   5.0  
12_02_0147 + 14403046-14403285,14403371-14404078,14404145-14404702     28   6.6  
08_01_1006 - 10191817-10191822,10192449-10192745,10192826-101929...    28   6.6  
03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324...    28   6.6  
03_06_0030 + 31161821-31161927,31163700-31163934,31164064-311648...    28   6.6  
02_04_0179 + 20682852-20684510,20684593-20684661,20684741-206848...    28   6.6  
12_02_0823 + 23461423-23462124                                         27   8.7  
12_02_0800 + 23299674-23299678,23299714-23299791,23299876-232999...    27   8.7  
12_01_0843 + 7891622-7892524                                           27   8.7  
06_01_0889 - 6807449-6809257                                           27   8.7  
02_05_0477 - 29339649-29340253,29340880-29341492                       27   8.7  
01_05_0719 + 24580765-24581090,24581285-24581401,24582739-245828...    27   8.7  

>05_04_0450 -
           21356877-21356942,21357482-21358095,21358173-21358566,
           21358648-21358704
          Length = 376

 Score =  134 bits (325), Expect = 4e-32
 Identities = 72/134 (53%), Positives = 82/134 (61%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           M DE++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   +
Sbjct: 1   MADEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           AK                      +             PE+HPVLLTEAPLNPKA   KM
Sbjct: 61  AKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEDHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNCPAM 133



 Score = 99.1 bits (236), Expect = 2e-21
 Identities = 56/106 (52%), Positives = 63/106 (59%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQ+KRG LTLKYPIEHGIV NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQAKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEDHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNCPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>03_05_0926 +
           28871800-28871859,28871943-28872336,28872586-28873199,
           28873281-28873346
          Length = 377

 Score =  132 bits (319), Expect = 2e-31
 Identities = 71/131 (54%), Positives = 80/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNTPAM 134



 Score =  102 bits (245), Expect = 2e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV+NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>01_06_1455 +
           37504175-37504231,37504357-37504750,37504865-37505478,
           37506021-37506086
          Length = 376

 Score =  132 bits (319), Expect = 2e-31
 Identities = 70/134 (52%), Positives = 82/134 (61%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           M +E++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   +
Sbjct: 1   MAEEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAP+NPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNCPAM 133



 Score =  100 bits (239), Expect = 1e-21
 Identities = 57/106 (53%), Positives = 63/106 (59%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNCPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>11_01_0403 +
           3059650-3059709,3059807-3060200,3060275-3060930,
           3060979-3061044
          Length = 391

 Score =  131 bits (317), Expect = 4e-31
 Identities = 71/131 (54%), Positives = 80/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNVPAM 134



 Score =  100 bits (240), Expect = 8e-22
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV+NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>10_08_0597 +
           19089616-19089675,19089789-19090182,19090451-19091064,
           19091160-19091225
          Length = 377

 Score =  131 bits (317), Expect = 4e-31
 Identities = 70/131 (53%), Positives = 81/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHP+LLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F+ PA+
Sbjct: 125 MF-ETFSVPAM 134



 Score =  100 bits (240), Expect = 8e-22
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV+NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFSVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>05_01_0047 -
           323097-323162,323287-323900,324233-324626,324718-324777
          Length = 377

 Score =  131 bits (317), Expect = 4e-31
 Identities = 71/131 (54%), Positives = 80/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNVPAM 134



 Score =  100 bits (240), Expect = 8e-22
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV+NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>03_06_0585 -
           34912159-34912224,34912634-34913247,34913350-34913734,
           34913824-34913883
          Length = 374

 Score =  131 bits (317), Expect = 4e-31
 Identities = 70/131 (53%), Positives = 80/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHP+LLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNAPAM 134



 Score = 98.7 bits (235), Expect = 3e-21
 Identities = 53/93 (56%), Positives = 58/93 (62%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFR 534
           EK     + +TF  P    V IQ VL  +   R
Sbjct: 119 EKMTQI-MFETFNAPA-MYVAIQAVLSLYASGR 149


>01_07_0285 -
           42476767-42476832,42476990-42477603,42477821-42478214,
           42478301-42478360
          Length = 377

 Score =  131 bits (317), Expect = 4e-31
 Identities = 71/131 (54%), Positives = 80/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNVPAM 134



 Score =  100 bits (240), Expect = 8e-22
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV+NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>12_02_1282 + 27528159-27529148,27529549-27529614
          Length = 351

 Score =  130 bits (315), Expect = 6e-31
 Identities = 70/131 (53%), Positives = 80/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           +++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   DDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNAPAM 134



 Score =  100 bits (239), Expect = 1e-21
 Identities = 57/106 (53%), Positives = 63/106 (59%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNAPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>12_01_0409 -
           3230853-3230918,3231372-3231994,3232454-3232847,
           3233000-3233059
          Length = 380

 Score =  130 bits (314), Expect = 8e-31
 Identities = 70/131 (53%), Positives = 79/131 (60%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHP LLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPALLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ESFNVPAM 134



 Score =  100 bits (239), Expect = 1e-21
 Identities = 56/106 (52%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV+NWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPALLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + ++F  P    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFESFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>08_02_0441 -
           17196352-17196536,17196780-17196906,17198018-17198101,
           17198282-17198348,17198575-17198633,17199211-17199336,
           17199406-17199474,17199545-17199653,17199692-17199760,
           17199876-17199979,17200518-17200567,17200696-17200774,
           17200867-17200938,17201083-17201217,17201311-17201421,
           17202088-17202129
          Length = 495

 Score = 54.8 bits (126), Expect = 5e-08
 Identities = 41/127 (32%), Positives = 57/127 (44%), Gaps = 7/127 (5%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVG-----VRHRA 268
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  +      D  VG     +RH+ 
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLQEQELTDIVVGAACADLRHQL 66

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
                           + G  W       S +     P E  +LLT+ PLNP     KM 
Sbjct: 67  DVSYPVTNGIVQSWDDM-GHIWDH--AFYSELK--VDPSECKILLTDPPLNPVKNREKMI 121

Query: 449 HIMFPKH 469
             MF K+
Sbjct: 122 ETMFEKY 128



 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 19/34 (55%), Positives = 24/34 (70%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           L + YP+ +GIV +WDDM  IW H FY+EL V P
Sbjct: 66  LDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDP 99


>08_01_0254 +
           2078380-2078392,2078487-2078578,2079579-2079698,
           2079924-2080097,2080184-2080257,2080847-2080927,
           2081306-2081366,2081437-2081486,2082278-2082332,
           2082599-2082676,2082757-2082810,2083703-2083756,
           2083846-2083906,2084229-2084280,2085118-2085184,
           2085393-2085452,2085546-2085608,2085752-2085814,
           2086337-2086401,2086620-2086688,2086742-2086847
          Length = 503

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 190
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 19/65 (29%), Positives = 30/65 (46%)
 Frame = +1

Query: 199 APPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVA 378
           A P   D       L    E + +R  + +  P++ G VT+WD ++ IW+H F   L + 
Sbjct: 105 AKPMDVDKAKTKRKLYVGQELEFRRDHMEVISPMKDGTVTDWDIVDNIWNHAFRQRLLIN 164

Query: 379 PRGTP 393
           P   P
Sbjct: 165 PEEHP 169



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKH 469
           PEEHP+L+ E   N      K   +MF K+
Sbjct: 165 PEEHPMLIAEPSTNTGQQREKAAELMFEKY 194


>01_01_0292 -
           2387653-2387711,2388061-2388684,2388814-2389104,
           2389338-2389390,2390496-2390968,2391090-2391432,
           2391793-2391911,2392081-2392512,2392657-2392747,
           2392833-2392942,2393681-2393875,2394581-2394622,
           2395144-2395268,2395856-2395926,2396047-2396147
          Length = 1042

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 31/122 (25%), Positives = 53/122 (43%), Gaps = 5/122 (4%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNG+   + G+AG+  PR  F +IV RPRH+      G+  + VG    A       
Sbjct: 22  IVIDNGASTFRIGWAGEAEPRVAFRNIVQRPRHR----SSGETVTVVGDTDPALMKYFDC 77

Query: 290 XXXXXXXXXLTGMTWR---RFGIIPSTMSWVSPPEE--HPVLLTEAPLNPKATERKMTHI 454
                       + ++      I+      +    E  HP+L+TE   NP  +  +M+ +
Sbjct: 78  TRSAIRSPFDDDVVYQFEYMEYILDFGFDRLGATSEVGHPILMTECECNPSFSRARMSEL 137

Query: 455 MF 460
           +F
Sbjct: 138 LF 139


>08_01_0194 -
           1603702-1603782,1603970-1604062,1604203-1604328,
           1604403-1604513,1604989-1605108,1605665-1605757,
           1606024-1606157,1606503-1606530,1606821-1607075,
           1607167-1607401,1608147-1608193
          Length = 440

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +1

Query: 274 GFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           G  T K+PI HG V +WD ME+ W    +N L   P
Sbjct: 82  GLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNP 117



 Score = 34.3 bits (75), Expect = 0.076
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 193
           A+V+DNG+G  K GF+G+  P    P++V
Sbjct: 8   AVVIDNGTGYSKLGFSGNSEPCFTIPTVV 36


>01_01_1170 -
           9318332-9318461,9318551-9318613,9318694-9318744,
           9318837-9318921,9319005-9319068,9319139-9319340,
           9319808-9320502
          Length = 429

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           +V+DNG G+ KAGF GD  P AV P+ + +P
Sbjct: 8   VVLDNGGGLLKAGFGGDMNPTAVVPNCMAKP 38



 Score = 28.3 bits (60), Expect = 5.0
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGT 390
           +TL+ PI+ G + N +   ++W     N L V P  +
Sbjct: 60  MTLRRPIDRGYLINQEVQREVWERVIRNLLQVDPNNS 96


>02_04_0473 +
           23197294-23197340,23197443-23197680,23197792-23198016,
           23198616-23198762,23198827-23198961,23199415-23199507,
           23199925-23200044,23200303-23200413,23200486-23200611,
           23200731-23200829,23201024-23201104
          Length = 473

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +1

Query: 235 EGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           E  L RS + +      L YPI +G V NWD ME+ W    +N L   P
Sbjct: 73  EDALARSRSSNT---YNLSYPIHNGQVENWDTMERFWQQCIFNYLRCDP 118



 Score = 34.7 bits (76), Expect = 0.057
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 193
           A+V+DNG+G  K GFAG+  P  + P++V
Sbjct: 8   AVVIDNGTGYTKMGFAGNVEPCFITPTVV 36



 Score = 31.5 bits (68), Expect = 0.53
 Identities = 14/27 (51%), Positives = 16/27 (59%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMF 460
           PE+H  LLTE+PL P  T      IMF
Sbjct: 118 PEDHYFLLTESPLTPPETREYTGEIMF 144


>04_03_0738 +
           19169764-19169897,19169987-19170116,19170614-19170687,
           19171208-19171288,19172054-19172087
          Length = 150

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 11/33 (33%), Positives = 18/33 (54%)
 Frame = +1

Query: 295 PIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           P++ G   +WD ++ IW+H F   L + P   P
Sbjct: 92  PMKDGTFIDWDIVDNIWNHAFRQRLLINPEEHP 124


>03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093
          Length = 435

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = -2

Query: 308 PCSMGYLRVRKPLLLCASLLHKSPSVPYRPSRPDGGAFPR 189
           PCS  +      L+LC S   + P+V +RP+ PDGGA P+
Sbjct: 192 PCSRSH-----DLILCNSQ-SRCPTVQHRPTPPDGGAPPK 225


>06_01_0824 -
           6219477-6219556,6220427-6220808,6221415-6221448,
           6222214-6222370,6224449-6224575,6224663-6224914
          Length = 343

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = +1

Query: 382 RGTPSPAH*GSPQPQGHREKDDPYHVSKTFY 474
           RGTP P     PQPQ H      YH S+++Y
Sbjct: 150 RGTPPPPAQMMPQPQHHGPPATIYHPSQSWY 180


>03_05_0520 +
           25139314-25139364,25139580-25139711,25141594-25141731,
           25143191-25143241,25143662-25143751,25143854-25144000,
           25144108-25144218,25144307-25144375,25144777-25145517,
           25145840-25146004,25146376-25146442,25146580-25146704,
           25148714-25148983,25149065-25149199,25149316-25149497,
           25149669-25149744
          Length = 849

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 14/47 (29%), Positives = 27/47 (57%)
 Frame = +2

Query: 347 IIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           ++P++++  S PE  P + T AP N  +T +   ++ FP   + PA+
Sbjct: 342 VLPASVTARSAPENIPAV-TSAPANSSSTLKDDDNMSFPSRRSSPAV 387


>07_03_1713 +
           28939446-28939574,28939674-28940231,28940338-28940460,
           28940676-28940912
          Length = 348

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 13/36 (36%), Positives = 17/36 (47%)
 Frame = +1

Query: 376 APRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPR 483
           AP   P+  H   P P  +RE    YH +  FY P+
Sbjct: 125 APPPPPAYGHQAYPPPPPNREPGHGYHPAPAFYPPQ 160


>07_03_0401 +
           17724103-17724463,17724554-17724683,17725068-17725083,
           17725130-17725203,17725693-17725761,17726224-17726257
          Length = 227

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 9/31 (29%), Positives = 19/31 (61%)
 Frame = +1

Query: 265 SKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           ++R  + +  P++ G   +WD ++ IW+H F
Sbjct: 163 NRRDHMEVISPMKDGTFIDWDIVDNIWNHAF 193


>07_03_0143 -
           14315097-14315130,14315594-14315662,14316152-14316225,
           14316316-14316331,14316716-14316845,14316936-14316999
          Length = 128

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 9/31 (29%), Positives = 19/31 (61%)
 Frame = +1

Query: 265 SKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           ++R  + +  P++ G   +WD ++ IW+H F
Sbjct: 64  NRRDHMEVISPMKDGTFIDWDIVDNIWNHAF 94


>05_04_0299 -
           19958776-19958858,19958883-19959012,19960131-19960175,
           19960252-19960370,19960450-19960543,19961824-19961985,
           19962117-19962266,19962472-19962537,19962934-19962981,
           19963654-19963866,19963953-19964078,19964155-19964232,
           19964600-19964671,19965522-19965953,19966863-19966925,
           19967497-19967898
          Length = 760

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = -1

Query: 507 GLNADGTMAGRVK-CFGNMIWVIFLSVALGLRGASVSRTGCSSGGDTQLIVEG 352
           G N DG  A  ++ CFG ++     S A+  +   V +T    GG   ++V+G
Sbjct: 315 GRNTDGVQAEPLRNCFGYLLIQALASSAIWDQDPKVMKTFVQFGGPPNILVDG 367


>03_05_0812 +
           27890030-27890219,27890618-27890916,27891603-27891840,
           27892098-27892433,27892522-27892607,27892703-27892810,
           27892918-27893225,27893304-27893567,27893660-27894431
          Length = 866

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 10/32 (31%), Positives = 19/32 (59%)
 Frame = +1

Query: 322 WDDMEKIWHHTFYNELGVAPRGTPSPAH*GSP 417
           +++ ++++ +  YN+LG    G P P   GSP
Sbjct: 194 YEEHDRVYRYDVYNDLGSPDSGNPRPILGGSP 225


>03_01_0470 +
           3619417-3619572,3619681-3619759,3620017-3620258,
           3620804-3621148,3623592-3624116
          Length = 448

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = -1

Query: 207 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 88
           WR  P +  + ARG S P + AL   +P++     +++ H
Sbjct: 251 WRRTPWVGAHAARGGSRPLRRALQGLDPVTIAAIFSTAEH 290


>12_01_0386 +
           3023431-3023522,3023951-3024097,3024227-3024308,
           3024801-3024842,3024930-3024989,3025430-3027109,
           3027239-3027340,3027461-3027604,3027704-3027829,
           3027933-3028100
          Length = 880

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = -1

Query: 414 GASVSRTGCSSGGDTQLIVEGMMPNLLHVI 325
           G+  S  GC SGG    +V  +M + +HV+
Sbjct: 48  GSEASEAGCESGGAVCTLVRKIMASQVHVV 77


>03_05_1068 +
           30114682-30114868,30114947-30115239,30115354-30115591,
           30115977-30117871
          Length = 870

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = +1

Query: 322 WDDMEKIWHHTFYNELGVAPRGTPSPAH*GSP 417
           + + ++++ +  YN+LG    G P P   GSP
Sbjct: 191 YQEHDRVYRYDVYNDLGEPDSGNPRPVLGGSP 222


>12_02_0147 + 14403046-14403285,14403371-14404078,14404145-14404702
          Length = 501

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 116 VDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSY-VGVRH 262
           ++N S   K GF      + V  +++G P H G + G+  K S+  G +H
Sbjct: 322 IENLSSSQKKGFFKPKREKDVLSTVLGTPEHGGRVRGVSSKMSWKEGFKH 371


>08_01_1006 -
           10191817-10191822,10192449-10192745,10192826-10192975,
           10194558-10195370
          Length = 421

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -1

Query: 234 CPIPTITP*WRGLPTIEGNTARGASSPAK 148
           C +P   P +RG P++   T RG + PA+
Sbjct: 142 CDMPLAPPGFRGFPSLVSLTLRGVTLPAE 170


>03_06_0192 +
           32230953-32231030,32231130-32231485,32232250-32232425,
           32233857-32234038,32234260-32234443,32235192-32235259,
           32235343-32235495
          Length = 398

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFA-GDDAPRAVFPS 187
           A+VVD GS + KAG A  D +P  V PS
Sbjct: 3   AVVVDAGSKLLKAGIALPDQSPSLVMPS 30


>03_06_0030 + 31161821-31161927,31163700-31163934,31164064-31164826,
            31165816-31167650,31169294-31169424,31169993-31170075,
            31170426-31170680,31171125-31171220,31171695-31171775,
            31171811-31171968,31172434-31172534,31172614-31172629,
            31173390-31173439,31174558-31174588,31175156-31175305,
            31176135-31176173,31176288-31176410,31176496-31176552,
            31176837-31176911,31177003-31177107
          Length = 1496

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 4/33 (12%)
 Frame = -2

Query: 218  SRPDGGA---FPRSRGTRREEHHL-LRNRPCTY 132
            S+ D GA   +P+  GT R+  H+ ++NRPC +
Sbjct: 1333 SKADAGASKTYPQQAGTIRKNGHIVIKNRPCKW 1365


>02_04_0179 +
           20682852-20684510,20684593-20684661,20684741-20684809,
           20686779-20688206
          Length = 1074

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 15/32 (46%), Positives = 16/32 (50%)
 Frame = -2

Query: 245 KSPSVPYRPSRPDGGAFPRSRGTRREEHHLLR 150
           K P  P  P  PD  A  RSR TRR    +LR
Sbjct: 217 KLPPPPAPPPAPDDDAASRSRSTRRRLVKVLR 248


>12_02_0823 + 23461423-23462124
          Length = 233

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 3/39 (7%)
 Frame = -1

Query: 276 TSFALCLTPT*ESFCPIPT---ITP*WRGLPTIEGNTAR 169
           TS A     T  + CP P    +TP   G P+I GNTAR
Sbjct: 19  TSVAAATKLTLHNLCPYPVWPLVTPN-TGFPSISGNTAR 56


>12_02_0800 +
           23299674-23299678,23299714-23299791,23299876-23299920,
           23300052-23300415,23300493-23300574,23300793-23300873,
           23300974-23302106,23302202-23302350,23302426-23302516,
           23303628-23305940
          Length = 1446

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = -2

Query: 242 SPSVPYRPSRPDGGAFP 192
           +P  PYRP  P GG FP
Sbjct: 294 APGGPYRPLGPPGGGFP 310


>12_01_0843 + 7891622-7892524
          Length = 300

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAV 178
           E+V ++  D GSG  +AG  GD AP  V
Sbjct: 170 EDVTSVWRDGGSGAARAGDDGDGAPAFV 197


>06_01_0889 - 6807449-6809257
          Length = 602

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 6/55 (10%)
 Frame = +2

Query: 380 PEEHPVLLTE--APLNPKATERKMTHIM----FPKHFTRPAIVPSAFKPCFLLLH 526
           P+  P LL    A L P+A    +  ++     P HFT P ++P+A  P    LH
Sbjct: 65  PDPRPALLNPLFASLPPRAAASLLALMLSLPLLPDHFTFPRLLPAAPLPLAAQLH 119


>02_05_0477 - 29339649-29340253,29340880-29341492
          Length = 405

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 193
           + VAALV  N  G+ +    G+DA  A  PS++
Sbjct: 44  DAVAALVASNEDGVVEGEGEGEDAAEAPAPSVL 76


>01_05_0719 +
           24580765-24581090,24581285-24581401,24582739-24582866,
           24582938-24583036,24583126-24583284,24584113-24584199,
           24584324-24584415,24584570-24584644,24585257-24585424
          Length = 416

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 15/45 (33%), Positives = 20/45 (44%)
 Frame = +2

Query: 341 FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFT 475
           F I+ S   W     EH V   +A   P+A  RK+  I F +  T
Sbjct: 346 FLILASDGLWDVVSNEHAVAFVKAEEGPEAAARKLAEIAFARGST 390


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,179,639
Number of Sequences: 37544
Number of extensions: 572289
Number of successful extensions: 1937
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 1825
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1927
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1435654836
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).