SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0005
         (609 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_1540 - 34245246-34245797,34246904-34247157,34247989-34248577     29   2.2  
04_03_0601 - 17875540-17875776,17876611-17876736,17877700-178777...    28   6.7  
02_05_0440 - 29035974-29036356,29037977-29038133,29038260-290388...    28   6.7  

>04_04_1540 - 34245246-34245797,34246904-34247157,34247989-34248577
          Length = 464

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 14/40 (35%), Positives = 20/40 (50%)
 Frame = +3

Query: 105 NNAKHQIQKIQLSFCKELSLPDNHQVDKDHLETNHINITL 224
           +N  H IQ  Q+S  K++ +P  H +   HL  N    TL
Sbjct: 231 SNVSHMIQHTQVSLLKDVIVPYTHLLPTMHLSENKDRPTL 270


>04_03_0601 -
           17875540-17875776,17876611-17876736,17877700-17877727,
           17878131-17878936
          Length = 398

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 5/54 (9%)
 Frame = +1

Query: 328 SRCNYTETLELISQDG*RIYVV-----DVYGFQ*PLNTRWAVRSSTHLCSLKKN 474
           SRC+Y   +E  S    R Y       D  G + P+   WAVR++++    +KN
Sbjct: 213 SRCSYAALMESSSFSFRRSYATSSEFFDANGGRVPVVVEWAVRNASNCVEARKN 266


>02_05_0440 -
           29035974-29036356,29037977-29038133,29038260-29038824,
           29038866-29039191
          Length = 476

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 13/20 (65%), Positives = 16/20 (80%), Gaps = 2/20 (10%)
 Frame = +3

Query: 12  WV-PPAGREFGGG-RIPRER 65
           W+ PP+GRE GGG R+ RER
Sbjct: 343 WLFPPSGRESGGGDRVARER 362


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,496,539
Number of Sequences: 37544
Number of extensions: 356355
Number of successful extensions: 735
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 726
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 734
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1454766756
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).