SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0004
         (637 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585...   130   7e-31
03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731...   130   7e-31
01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054...   130   9e-31
11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306...   128   3e-30
05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32...   128   3e-30
01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782...   128   3e-30
12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323...   128   4e-30
03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137...   128   4e-30
12_02_1282 + 27528159-27529148,27529549-27529614                      127   8e-30
10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910...   126   1e-29
08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981...    71   6e-13
02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980...    60   1e-09
08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160...    58   6e-09
08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207...    58   8e-09
04_03_0738 + 19169764-19169897,19169987-19170116,19170614-191706...    53   2e-07
07_03_0401 + 17724103-17724463,17724554-17724683,17725068-177250...    44   8e-05
01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238...    42   5e-04
07_03_0143 - 14315097-14315130,14315594-14315662,14316152-143162...    41   7e-04
01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931...    40   0.002
06_01_0099 + 824557-825532,826090-826245,826422-828064                 30   1.3  
01_05_0791 + 25267885-25267930,25268258-25268713,25268802-252688...    29   2.3  
05_01_0442 - 3500849-3500866,3500950-3501027,3501260-3501352,350...    29   3.1  
03_01_0470 + 3619417-3619572,3619681-3619759,3620017-3620258,362...    29   4.1  
02_05_1265 - 35326506-35326773,35326944-35327109,35327194-353273...    29   4.1  
10_08_0029 + 14270945-14271364,14271449-14272486                       28   5.4  
08_01_0625 + 5444547-5444912                                           28   5.4  
04_03_0792 + 19693957-19694146,19695614-19696260                       28   5.4  
02_04_0179 + 20682852-20684510,20684593-20684661,20684741-206848...    28   5.4  
08_01_1006 - 10191817-10191822,10192449-10192745,10192826-101929...    28   7.1  
07_03_0263 - 15951011-15951818,15952009-15952526,15952949-159531...    28   7.1  
05_05_0048 + 21884078-21884951,21885586-21885899                       28   7.1  
03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324...    28   7.1  
03_06_0030 + 31161821-31161927,31163700-31163934,31164064-311648...    28   7.1  
03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093     28   7.1  
03_03_0279 - 16134422-16134608,16134703-16134947,16135046-161353...    28   7.1  
01_06_0080 + 26246857-26247459                                         28   7.1  
12_02_0800 + 23299674-23299678,23299714-23299791,23299876-232999...    27   9.4  
12_01_0981 + 9931542-9931606,9931779-9933105                           27   9.4  
12_01_0843 + 7891622-7892524                                           27   9.4  
11_01_0385 + 2915532-2916482                                           27   9.4  
11_01_0055 + 421459-421620,422356-422697,422934-423051,423132-42...    27   9.4  
08_01_0364 - 3218309-3218414,3218882-3218941,3219898-3219969,322...    27   9.4  
07_03_0207 - 15183894-15184685,15184993-15185078,15186042-151861...    27   9.4  
05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613,287...    27   9.4  
02_05_0749 + 31468643-31469086                                         27   9.4  
02_05_0477 - 29339649-29340253,29340880-29341492                       27   9.4  

>05_04_0450 -
           21356877-21356942,21357482-21358095,21358173-21358566,
           21358648-21358704
          Length = 376

 Score =  130 bits (315), Expect = 7e-31
 Identities = 68/131 (51%), Positives = 77/131 (58%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           M DE++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQ
Sbjct: 1   MADEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           +KR                     +             P +    L   P  P+A   KM
Sbjct: 61  AKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEDHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNCP 131



 Score =  120 bits (288), Expect = 1e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPE+HPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEDHPVLLTEAPLNPKANREK 119


>03_05_0926 +
           28871800-28871859,28871943-28872336,28872586-28873199,
           28873281-28873346
          Length = 377

 Score =  130 bits (315), Expect = 7e-31
 Identities = 69/128 (53%), Positives = 75/128 (58%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFNTP
Sbjct: 125 MFETFNTP 132



 Score =  121 bits (292), Expect = 4e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 120


>01_06_1455 +
           37504175-37504231,37504357-37504750,37504865-37505478,
           37506021-37506086
          Length = 376

 Score =  130 bits (314), Expect = 9e-31
 Identities = 68/131 (51%), Positives = 76/131 (58%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           M +E++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQ
Sbjct: 1   MAEEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNCP 131



 Score =  120 bits (289), Expect = 1e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA +NPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKANREK 119


>11_01_0403 +
           3059650-3059709,3059807-3060200,3060275-3060930,
           3060979-3061044
          Length = 391

 Score =  128 bits (310), Expect = 3e-30
 Identities = 68/128 (53%), Positives = 74/128 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFN P
Sbjct: 125 MFETFNVP 132



 Score =  121 bits (292), Expect = 4e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 120


>05_01_0047 -
           323097-323162,323287-323900,324233-324626,324718-324777
          Length = 377

 Score =  128 bits (310), Expect = 3e-30
 Identities = 68/128 (53%), Positives = 74/128 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFN P
Sbjct: 125 MFETFNVP 132



 Score =  121 bits (292), Expect = 4e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 120


>01_07_0285 -
           42476767-42476832,42476990-42477603,42477821-42478214,
           42478301-42478360
          Length = 377

 Score =  128 bits (310), Expect = 3e-30
 Identities = 68/128 (53%), Positives = 74/128 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFN P
Sbjct: 125 MFETFNVP 132



 Score =  121 bits (292), Expect = 4e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 120


>12_01_0409 -
           3230853-3230918,3231372-3231994,3232454-3232847,
           3233000-3233059
          Length = 380

 Score =  128 bits (309), Expect = 4e-30
 Identities = 67/128 (52%), Positives = 75/128 (58%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P    + L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPALLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFE+FN P
Sbjct: 125 MFESFNVP 132



 Score =  120 bits (288), Expect = 1e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPALLTEAPLNPKANREK 120


>03_06_0585 -
           34912159-34912224,34912634-34913247,34913350-34913734,
           34913824-34913883
          Length = 374

 Score =  128 bits (309), Expect = 4e-30
 Identities = 68/128 (53%), Positives = 74/128 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFN P
Sbjct: 125 MFETFNAP 132



 Score =  120 bits (290), Expect = 7e-28
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 120


>12_02_1282 + 27528159-27529148,27529549-27529614
          Length = 351

 Score =  127 bits (306), Expect = 8e-30
 Identities = 67/128 (52%), Positives = 74/128 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           +++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   DDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETFN P
Sbjct: 125 MFETFNAP 132



 Score =  121 bits (291), Expect = 6e-28
 Identities = 52/58 (89%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 120


>10_08_0597 +
           19089616-19089675,19089789-19090182,19090451-19091064,
           19091160-19091225
          Length = 377

 Score =  126 bits (305), Expect = 1e-29
 Identities = 67/128 (52%), Positives = 74/128 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   KMTQI
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI 124

Query: 435 MFETFNTP 458
           MFETF+ P
Sbjct: 125 MFETFSVP 132



 Score =  121 bits (291), Expect = 6e-28
 Identities = 51/58 (87%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 120


>08_02_0441 -
           17196352-17196536,17196780-17196906,17198018-17198101,
           17198282-17198348,17198575-17198633,17199211-17199336,
           17199406-17199474,17199545-17199653,17199692-17199760,
           17199876-17199979,17200518-17200567,17200696-17200774,
           17200867-17200938,17201083-17201217,17201311-17201421,
           17202088-17202129
          Length = 495

 Score = 71.3 bits (167), Expect = 6e-13
 Identities = 30/54 (55%), Positives = 38/54 (70%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+  LNP  NREK
Sbjct: 66  LDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREK 119



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>02_04_0473 +
           23197294-23197340,23197443-23197680,23197792-23198016,
           23198616-23198762,23198827-23198961,23199415-23199507,
           23199925-23200044,23200303-23200413,23200486-23200611,
           23200731-23200829,23201024-23201104
          Length = 473

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 26/51 (50%), Positives = 31/51 (60%)
 Frame = +2

Query: 266 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           L YPI +G V NWD ME+ W    +N LR  PE+H  LLTE+ L P   RE
Sbjct: 87  LSYPIHNGQVENWDTMERFWQQCIFNYLRCDPEDHYFLLTESPLTPPETRE 137



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 45/156 (28%), Positives = 69/156 (44%), Gaps = 21/156 (13%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPR---HQGVMVG------MGQK 218
           A+V+DNG+G  K GFAG+  P  + P++V       G+ R    +G  +       M   
Sbjct: 8   AVVIDNGTGYTKMGFAGNVEPCFITPTVVAVNDTFAGQTRANTTKGNWMAQHSAGVMADL 67

Query: 219 DSYVGDE--AQSKRVXXXXXXXXXXXXXLTGM-TWRRF--GIIPSTMSCVSPPRNTQSCL 383
           D ++G++  A+S+               +    T  RF    I + + C   P +    L
Sbjct: 68  DFFIGEDALARSRSSNTYNLSYPIHNGQVENWDTMERFWQQCIFNYLRC--DPEDHYFLL 125

Query: 384 LRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVL 491
              P TP  T     +IMFETFN P  + +A +PVL
Sbjct: 126 TESPLTPPETREYTGEIMFETFNVP-GLYIACQPVL 160


>08_01_0194 -
           1603702-1603782,1603970-1604062,1604203-1604328,
           1604403-1604513,1604989-1605108,1605665-1605757,
           1606024-1606157,1606503-1606530,1606821-1607075,
           1607167-1607401,1608147-1608193
          Length = 440

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 24/58 (41%), Positives = 35/58 (60%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           +   + T K+PI HG V +WD ME+ W    +N LR  PEEH  LLT++ ++   +RE
Sbjct: 79  KSSGLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYFLLTDSPVSTPESRE 136



 Score = 34.3 bits (75), Expect = 0.082
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 173
           A+V+DNG+G  K GF+G+  P    P++V
Sbjct: 8   AVVIDNGTGYSKLGFSGNSEPCFTIPTVV 36


>08_01_0254 +
           2078380-2078392,2078487-2078578,2079579-2079698,
           2079924-2080097,2080184-2080257,2080847-2080927,
           2081306-2081366,2081437-2081486,2082278-2082332,
           2082599-2082676,2082757-2082810,2083703-2083756,
           2083846-2083906,2084229-2084280,2085118-2085184,
           2085393-2085452,2085546-2085608,2085752-2085814,
           2086337-2086401,2086620-2086688,2086742-2086847
          Length = 503

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P++ G VT+WD ++ IW+H F   L + PEEHP+L+ E S N    REK
Sbjct: 137 PMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTNTGQQREK 185



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 170
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36


>04_03_0738 +
           19169764-19169897,19169987-19170116,19170614-19170687,
           19171208-19171288,19172054-19172087
          Length = 150

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 21/49 (42%), Positives = 30/49 (61%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P++ G   +WD ++ IW+H F   L + PEEHP+L+ E S N    REK
Sbjct: 92  PMKDGTFIDWDIVDNIWNHAFRQRLLINPEEHPMLIVEPSTNTGQQREK 140


>07_03_0401 +
           17724103-17724463,17724554-17724683,17725068-17725083,
           17725130-17725203,17725693-17725761,17726224-17726257
          Length = 227

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 20/49 (40%), Positives = 28/49 (57%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P++ G   +WD ++ IW+H F       PEEHP+L+ E S N    REK
Sbjct: 173 PMKDGTFIDWDIVDNIWNHAF----SFYPEEHPMLIVEPSTNTGQQREK 217


>01_01_0292 -
           2387653-2387711,2388061-2388684,2388814-2389104,
           2389338-2389390,2390496-2390968,2391090-2391432,
           2391793-2391911,2392081-2392512,2392657-2392747,
           2392833-2392942,2393681-2393875,2394581-2394622,
           2395144-2395268,2395856-2395926,2396047-2396147
          Length = 1042

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 236
           +V+DNG+   + G+AG+  PR  F +IV RPRH+      G+  + VGD
Sbjct: 22  IVIDNGASTFRIGWAGEAEPRVAFRNIVQRPRHR----SSGETVTVVGD 66



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +2

Query: 266 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ P +  +V  ++ ME I    F      +   HP+L+TE   NP  +R +
Sbjct: 82  IRSPFDDDVVYQFEYMEYILDFGFDRLGATSEVGHPILMTECECNPSFSRAR 133


>07_03_0143 -
           14315097-14315130,14315594-14315662,14316152-14316225,
           14316316-14316331,14316716-14316845,14316936-14316999
          Length = 128

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 19/49 (38%), Positives = 27/49 (55%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P++ G   +WD ++ IW+H F        EEHP+L+ E S N    REK
Sbjct: 74  PMKDGTFIDWDIVDNIWNHAF----SFYAEEHPMLIVEPSTNTGQQREK 118


>01_01_1170 -
           9318332-9318461,9318551-9318613,9318694-9318744,
           9318837-9318921,9319005-9319068,9319139-9319340,
           9319808-9320502
          Length = 429

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           +V+DNG G+ KAGF GD  P AV P+ + +P
Sbjct: 8   VVLDNGGGLLKAGFGGDMNPTAVVPNCMAKP 38



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/56 (30%), Positives = 27/56 (48%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREKDD 427
           +TL+ PI+ G + N +   ++W     N L+V P    +LL E   NP   +   D
Sbjct: 60  MTLRRPIDRGYLINQEVQREVWERVIRNLLQVDPNNSSLLLVEPQFNPPALQHATD 115


>06_01_0099 + 824557-825532,826090-826245,826422-828064
          Length = 924

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = +2

Query: 464 CTFGIQARASRCTPSVRTTRYSCWD-FPGTGVFPQPVPHFT 583
           C++G  A  S   PS++ T ++  D F GT V P P P FT
Sbjct: 115 CSYG-HAIFSGNAPSLKDTTFAIVDVFTGTSVSPPPCPFFT 154


>01_05_0791 +
           25267885-25267930,25268258-25268713,25268802-25268832,
           25268949-25269255
          Length = 279

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 16/51 (31%), Positives = 21/51 (41%)
 Frame = +2

Query: 455 APPCTFGIQARASRCTPSVRTTRYSCWDFPGTGVFPQPVPHFTERDTPLFP 607
           A  C FG  A  +   PS  + +YS     G  + P P P      TP+ P
Sbjct: 151 ATSCDFGGTATITNTDPSSGSCQYSASSGGGQNMLPPPSPTTLPPPTPMTP 201


>05_01_0442 -
           3500849-3500866,3500950-3501027,3501260-3501352,
           3501419-3501536,3502815-3502945,3503027-3503299,
           3504825-3504882,3505065-3505388,3507404-3507852,
           3509514-3509554,3510263-3510412,3510519-3510906
          Length = 706

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 17/56 (30%), Positives = 23/56 (41%)
 Frame = +2

Query: 386 EASLNPKGNREKDDPDHVRNI*HAPPCTFGIQARASRCTPSVRTTRYSCWDFPGTG 553
           EA+    G+   DDP   R      P T G + +A+R  P     R     FP +G
Sbjct: 55  EATTGAGGDVASDDPGPARKKGKVQPATKGAKGKAARADPPTPPPRPRLPPFPKSG 110


>03_01_0470 +
           3619417-3619572,3619681-3619759,3620017-3620258,
           3620804-3621148,3623592-3624116
          Length = 448

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = -1

Query: 187 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 68
           WR  P +  + ARG S P + AL   +P++     +++ H
Sbjct: 251 WRRTPWVGAHAARGGSRPLRRALQGLDPVTIAAIFSTAEH 290


>02_05_1265 -
           35326506-35326773,35326944-35327109,35327194-35327351,
           35327779-35327966,35328046-35328156,35328311-35328476,
           35328718-35328885,35329374-35330623
          Length = 824

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = -3

Query: 533 STNTGWYGRKAYSEKHGLECQTYMAG 456
           S N  + GR   + KHGL CQTY  G
Sbjct: 130 SDNIVYKGRWKLNRKHGLGCQTYPNG 155


>10_08_0029 + 14270945-14271364,14271449-14272486
          Length = 485

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 3/38 (7%)
 Frame = -2

Query: 240 PHLLHKSPSVPY---RPSRPDGGAFPRSRGTRREEHHL 136
           PHL    P  P+   +PSR  GG  PRS   +R   H+
Sbjct: 380 PHLPQPPPPPPHFERQPSRRRGGGVPRSVKMQRSSSHV 417


>08_01_0625 + 5444547-5444912
          Length = 121

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +1

Query: 529 VLGLPGNRCFSTTRAPFYRKG 591
           VL LP  RCFS+T A  YR+G
Sbjct: 64  VLLLPPRRCFSSTVAAGYRRG 84


>04_03_0792 + 19693957-19694146,19695614-19696260
          Length = 278

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 11/35 (31%), Positives = 20/35 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRH 464
           PRN  + L  LP+T  A +    +++++ +N  RH
Sbjct: 73  PRNQDTGLAELPATVAALKNPNPKVVYDEYNHERH 107


>02_04_0179 +
           20682852-20684510,20684593-20684661,20684741-20684809,
           20686779-20688206
          Length = 1074

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 16/37 (43%), Positives = 17/37 (45%)
 Frame = -2

Query: 240 PHLLHKSPSVPYRPSRPDGGAFPRSRGTRREEHHLLR 130
           P    K P  P  P  PD  A  RSR TRR    +LR
Sbjct: 212 PDEASKLPPPPAPPPAPDDDAASRSRSTRRRLVKVLR 248


>08_01_1006 -
           10191817-10191822,10192449-10192745,10192826-10192975,
           10194558-10195370
          Length = 421

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -1

Query: 214 CPIPTITP*WRGLPTIEGNTARGASSPAK 128
           C +P   P +RG P++   T RG + PA+
Sbjct: 142 CDMPLAPPGFRGFPSLVSLTLRGVTLPAE 170


>07_03_0263 -
           15951011-15951818,15952009-15952526,15952949-15953197,
           15953270-15953857
          Length = 720

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 1/50 (2%)
 Frame = -3

Query: 260 GYSFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIIS-CETGLAH 114
           GY F  C+ +++ VL    DH  ++     D G      IIS C   L H
Sbjct: 447 GY-FKKCVDNFLHVLKQEEDHGPMVEEAKDDGGSTSEDEIISMCRNNLVH 495


>05_05_0048 + 21884078-21884951,21885586-21885899
          Length = 395

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = +3

Query: 405 RATERKMTQIMFETFNTPRHVRLAFKPVLLAVRLP 509
           R + R   ++   TFNTP    LA+    L+VR P
Sbjct: 177 RDSTRNGARVWLGTFNTPEQAALAYDQAALSVRGP 211


>03_06_0192 +
           32230953-32231030,32231130-32231485,32232250-32232425,
           32233857-32234038,32234260-32234443,32235192-32235259,
           32235343-32235495
          Length = 398

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFA-GDDAPRAVFPS 167
           A+VVD GS + KAG A  D +P  V PS
Sbjct: 3   AVVVDAGSKLLKAGIALPDQSPSLVMPS 30


>03_06_0030 + 31161821-31161927,31163700-31163934,31164064-31164826,
            31165816-31167650,31169294-31169424,31169993-31170075,
            31170426-31170680,31171125-31171220,31171695-31171775,
            31171811-31171968,31172434-31172534,31172614-31172629,
            31173390-31173439,31174558-31174588,31175156-31175305,
            31176135-31176173,31176288-31176410,31176496-31176552,
            31176837-31176911,31177003-31177107
          Length = 1496

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 4/33 (12%)
 Frame = -2

Query: 198  SRPDGGA---FPRSRGTRREEHHL-LRNRPCTY 112
            S+ D GA   +P+  GT R+  H+ ++NRPC +
Sbjct: 1333 SKADAGASKTYPQQAGTIRKNGHIVIKNRPCKW 1365


>03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093
          Length = 435

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = -2

Query: 225 KSPSVPYRPSRPDGGAFPR 169
           + P+V +RP+ PDGGA P+
Sbjct: 207 RCPTVQHRPTPPDGGAPPK 225


>03_03_0279 -
           16134422-16134608,16134703-16134947,16135046-16135364,
           16135451-16135675,16135780-16135946,16136030-16136146,
           16136234-16136407,16136489-16136584,16136669-16136885,
           16137005-16137123,16137249-16137441,16137562-16137713,
           16137809-16137938,16138667-16138776
          Length = 816

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = +2

Query: 239 GTEQKSILTLKYPIEHGIVTNWDDMEKIW 325
           GTE   IL + +  E+GIV  W    ++W
Sbjct: 361 GTEHTHILRVPFRTENGIVRKWISRFEVW 389


>01_06_0080 + 26246857-26247459
          Length = 200

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%)
 Frame = -1

Query: 619 EMGVGEKWGIPFGKMGHGLW--KNTGSREVPARIPG 518
           E GVGE  G  FG    G+W  +  G+   PA + G
Sbjct: 96  EHGVGEDHGSVFGGGSGGMWRRRRMGTTSAPAAVDG 131


>12_02_0800 +
           23299674-23299678,23299714-23299791,23299876-23299920,
           23300052-23300415,23300493-23300574,23300793-23300873,
           23300974-23302106,23302202-23302350,23302426-23302516,
           23303628-23305940
          Length = 1446

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = -2

Query: 222 SPSVPYRPSRPDGGAFP 172
           +P  PYRP  P GG FP
Sbjct: 294 APGGPYRPLGPPGGGFP 310


>12_01_0981 + 9931542-9931606,9931779-9933105
          Length = 463

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 18/58 (31%), Positives = 24/58 (41%), Gaps = 3/58 (5%)
 Frame = +3

Query: 450 NTPR--HVRLAFKPVLLA-VRLPSVPPGIRAGTSREPVFFHNPCPILPKGIPHFSPTP 614
           N+P   ++ +   P L+  + LP  PP     T R    F N   I P   PHF   P
Sbjct: 26  NSPNQENIEMTMTPSLVTTLPLPPPPPNHIPTTERNTSVFFNTSTIPPPPPPHFPQPP 83


>12_01_0843 + 7891622-7892524
          Length = 300

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAV 158
           E+V ++  D GSG  +AG  GD AP  V
Sbjct: 170 EDVTSVWRDGGSGAARAGDDGDGAPAFV 197


>11_01_0385 + 2915532-2916482
          Length = 316

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = +2

Query: 533 WDFPGTGVFPQPVPHFTERDTPLFPH 610
           W  PG   +P P+P F +  TP +PH
Sbjct: 171 WPRPGNNQWP-PLPPFNQPPTPEWPH 195


>11_01_0055 +
           421459-421620,422356-422697,422934-423051,423132-423355,
           423711-424127
          Length = 420

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = -1

Query: 568 GLWKNTGSREVPARIPGGTDGRRTARSTGLNAKRTWR 458
           G+W    ++EV   +   TD  + A+     A RTWR
Sbjct: 282 GIWDVLSNKEVIKIVSSATDHSKAAKQLVERAVRTWR 318


>08_01_0364 -
           3218309-3218414,3218882-3218941,3219898-3219969,
           3220080-3223195,3223303-3223561,3223665-3223951,
           3224029-3224364,3224463-3224604,3224690-3224910,
           3224990-3225151,3225242-3225400,3225488-3225787,
           3226306-3226569,3227370-3227453
          Length = 1855

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = -3

Query: 482 LECQTYMAGRVKCFEHDLGHLSLCCP 405
           ++C+T MAG  +C  H  GHL L  P
Sbjct: 64  IKCETCMAGMAECPGH-FGHLELAKP 88


>07_03_0207 -
           15183894-15184685,15184993-15185078,15186042-15186144,
           15186890-15186971,15187112-15187203,15187295-15187383,
           15187467-15187547,15188610-15188724,15188894-15188935
          Length = 493

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = -1

Query: 379 QDWVFLGGDTQLIVEGMMPNLLHVIPV 299
           Q W+   G T L+V  M P+L++V+ V
Sbjct: 13  QQWIDKEGKTPLMVASMRPDLINVVQV 39


>05_01_0367 -
           2874429-2874483,2876274-2876345,2876453-2879613,
           2879715-2879973,2880060-2880346,2880423-2880758,
           2880862-2881003,2881077-2881297,2881379-2881540,
           2881617-2881775,2881860-2882159,2882834-2883097,
           2883133-2883243,2883902-2883988
          Length = 1871

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = -3

Query: 482 LECQTYMAGRVKCFEHDLGHLSLCCP 405
           ++C+T MAG  +C  H  GHL L  P
Sbjct: 102 IKCETCMAGMAECPGH-FGHLELAKP 126


>02_05_0749 + 31468643-31469086
          Length = 147

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 12/39 (30%), Positives = 18/39 (46%)
 Frame = -1

Query: 562 WKNTGSREVPARIPGGTDGRRTARSTGLNAKRTWRGVLN 446
           W++    + PAR     +G   A       +R WRGV+N
Sbjct: 11  WRDGSGGQRPARSARQREGEHGADDVEGGGRRWWRGVMN 49


>02_05_0477 - 29339649-29340253,29340880-29341492
          Length = 405

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 173
           + VAALV  N  G+ +    G+DA  A  PS++
Sbjct: 44  DAVAALVASNEDGVVEGEGEGEDAAEAPAPSVL 76


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,416,296
Number of Sequences: 37544
Number of extensions: 594723
Number of successful extensions: 2004
Number of sequences better than 10.0: 46
Number of HSP's better than 10.0 without gapping: 1893
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2001
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1561213104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).