SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0002
         (607 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_0219 + 1863478-1864041,1864459-1865109                           33   0.23 
07_03_0899 + 22421038-22422642                                         31   0.94 
01_01_0218 + 1856104-1856700,1856814-1857452                           29   2.2  
12_01_1080 + 11241590-11241625,11241723-11242018,11242113-112422...    28   5.0  
05_06_0043 + 25143513-25143866,25144010-25144191,25144284-251443...    28   5.0  
05_04_0441 - 21271106-21271495,21271608-21271751,21272639-212727...    28   5.0  
07_03_0898 - 22403337-22404950                                         28   6.6  
02_05_0624 - 30451032-30451140,30451294-30451409,30451506-304515...    28   6.6  
02_04_0202 - 20876793-20877142,20877380-20879512,20884063-20884732     28   6.6  
01_06_1468 + 37574124-37574180,37574275-37574346,37574437-375745...    28   6.6  
01_05_0615 - 23678493-23678948,23679057-23679441,23680250-236805...    28   6.6  
06_03_0670 - 23336385-23336504,23336769-23337092,23338315-233383...    27   8.7  

>01_01_0219 + 1863478-1864041,1864459-1865109
          Length = 404

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 23/67 (34%), Positives = 27/67 (40%)
 Frame = +1

Query: 85  VVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYIPWTL 264
           V D  Y   F    A R G LI E+ +P           VS+ RWR     TL Y  W  
Sbjct: 290 VSDERYFPAFRDSCAGRRGCLIDEHYIPT---------LVSLLRWRRNANRTLTYTEWRP 340

Query: 265 HMNHPRN 285
              HPR+
Sbjct: 341 RRPHPRS 347


>07_03_0899 + 22421038-22422642
          Length = 534

 Score = 30.7 bits (66), Expect = 0.94
 Identities = 16/40 (40%), Positives = 23/40 (57%)
 Frame = +3

Query: 375 CDRLWVFRRLALMDTTTLPNGVAPYTLKCFLTLNNLNSKL 494
           C+R W  RRLA + T T   GV  Y +   L++ +L+S L
Sbjct: 330 CERRWALRRLAAITTATFGVGVVYYGMP--LSVGSLSSDL 367


>01_01_0218 + 1856104-1856700,1856814-1857452
          Length = 411

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = +1

Query: 202 VSVPRWRSGIPATLNYIPWTLHMNHPRN 285
           VS+ RWR     TL Y+ W     HPR+
Sbjct: 327 VSLLRWRRNANRTLTYMEWRPRSPHPRS 354


>12_01_1080 + 11241590-11241625,11241723-11242018,11242113-11242269,
            11242381-11242449,11242551-11243480,11243868-11243906,
            11244414-11244478,11244663-11244768,11244850-11245050,
            11247001-11247201,11247756-11247779,11249425-11249586,
            11249676-11249915,11250267-11250479,11250618-11250968,
            11251041-11251193,11251649-11251858,11252049-11252267,
            11252365-11252482,11252879-11253828,11254023-11254220,
            11254294-11254553,11255316-11255505,11255817-11256169,
            11258278-11258386,11258466-11258615,11258748-11258844,
            11259315-11259415
          Length = 2065

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 18/51 (35%), Positives = 26/51 (50%)
 Frame = +3

Query: 114  LEAAGSQDWCSDTRERTARWYRKVEEQIVRQRS*VALRYSSYFELHSLDAP 266
            L  AGS D      E T RW R +E  I+RQ S   + ++  F++ +L  P
Sbjct: 1470 LMMAGSNDSIEMWDELTRRWNRVIE--IMRQNSVKKMTWNLKFQIQALKYP 1518


>05_06_0043 +
           25143513-25143866,25144010-25144191,25144284-25144374,
           25144452-25144568,25144922-25144976,25145008-25145093,
           25145190-25145300,25145564-25145608,25145695-25145740,
           25146078-25146152,25146902-25146971,25147128-25147437,
           25147778-25147851,25147996-25148151,25148416-25148539
          Length = 631

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 10/28 (35%), Positives = 18/28 (64%)
 Frame = +3

Query: 114 LEAAGSQDWCSDTRERTARWYRKVEEQI 197
           +E   S+  CS+T E+  RWY + +E++
Sbjct: 246 IETIRSEFSCSETCEKLQRWYGETDEEV 273


>05_04_0441 -
           21271106-21271495,21271608-21271751,21272639-21272746,
           21272846-21272859,21273103-21273154,21273592-21273656,
           21274447-21274579,21275260-21275341,21275639-21275715,
           21276037-21276093
          Length = 373

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +3

Query: 423 TLPNGVAPYTLKCFLTLNNLNSKLIRKNTLF 515
           TLP GV     +C L ++NLN+  I ++ LF
Sbjct: 174 TLPPGVTGTNERCTLIVSNLNTDKINEDKLF 204


>07_03_0898 - 22403337-22404950
          Length = 537

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +3

Query: 378 DRLWVFRRLALMDTTTLPNGVAPYTLKCFLTLNNLNSKL 494
           +R W F+RLA M T +   GV  Y L   L++ +L+S L
Sbjct: 323 ERRWAFQRLAAMMTASFGVGVVYYGLP--LSVGSLSSDL 359


>02_05_0624 -
           30451032-30451140,30451294-30451409,30451506-30451580,
           30452033-30452093,30452198-30452424
          Length = 195

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +1

Query: 85  VVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNK 195
           +VD    DQ  K   +R    I E+  P G ++WRNK
Sbjct: 146 LVDELLSDQHLKNYRMRKVREIQESRTPGGSQKWRNK 182


>02_04_0202 - 20876793-20877142,20877380-20879512,20884063-20884732
          Length = 1050

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = -1

Query: 67  LGALSLLMLVNLAHRKLKTSLP 2
           LGALS+L  +NL+H  L  S+P
Sbjct: 614 LGALSMLEALNLSHNTLNGSIP 635


>01_06_1468 +
           37574124-37574180,37574275-37574346,37574437-37574513,
           37574897-37574978,37576005-37576069,37576313-37576354,
           37576452-37576503,37576631-37576679,37576784-37576797,
           37576942-37577049,37577129-37577272,37577421-37577810
          Length = 383

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +3

Query: 423 TLPNGVAPYTLKCFLTLNNLNSKLIRKNTLF 515
           TLP GV+    +C L ++NLN+  I ++ LF
Sbjct: 184 TLPPGVSGINDRCTLLVSNLNTDKIDEDKLF 214


>01_05_0615 -
           23678493-23678948,23679057-23679441,23680250-23680545,
           23680983-23681504
          Length = 552

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 3/58 (5%)
 Frame = -3

Query: 227 PERHLGTLTNNLFLHLSIPTGSAFSGIRAPVLRACCFE---NWSG*FQSTTFHENISW 63
           P   L  L + LFL+L I   S    +  PV  ACC E    W G   S   +E   W
Sbjct: 166 PVFQLEKLKSILFLYLIIEMSSENVQLMLPVFSACCEELISRWMGSIGSDGSYEVDCW 223


>06_03_0670 -
           23336385-23336504,23336769-23337092,23338315-23338387,
           23338715-23338761,23338955-23339104,23339409-23339474,
           23339940-23340013,23340740-23341520,23341730-23342146,
           23344001-23344003
          Length = 684

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 18/76 (23%), Positives = 32/76 (42%)
 Frame = +3

Query: 18  SFLWARFTSISNDKAPRNILVERGRLELPGPVLEAAGSQDWCSDTRERTARWYRKVEEQI 197
           S  W +   ++N +   NI  +    EL  P  EA  +    S + E +A W+ K++  +
Sbjct: 372 SISWEQEALLTNLRLTLNISTDEHLAELRRPKSEACKASFCRSMSMEESATWFAKLQRDL 431

Query: 198 VRQRS*VALRYSSYFE 245
             +     L    YF+
Sbjct: 432 QSEYDLQRLCKRPYFK 447


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,628,432
Number of Sequences: 37544
Number of extensions: 384959
Number of successful extensions: 979
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 926
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 979
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1442939384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).