BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40047 (876 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41219| Best HMM Match : EF1G (HMM E-Value=3.3e-38) 73 3e-13 SB_21463| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_45563| Best HMM Match : TMS_TDE (HMM E-Value=2.2e-10) 29 3.7 SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012) 29 4.9 SB_24051| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_38036| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_23539| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_41219| Best HMM Match : EF1G (HMM E-Value=3.3e-38) Length = 90 Score = 72.9 bits (171), Expect = 3e-13 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 3/58 (5%) Frame = +1 Query: 358 TFNMDDFKRVYSNED-EAKSIPYFWEKFDPENYSIWYAEYK--YPEELAKVFMTVTLL 522 + N+D +K+VYSNED E+K+IPYFWE FD E YS+W+ EYK Y ++L VFM L+ Sbjct: 2 SMNLDAWKKVYSNEDTESKAIPYFWENFDKEGYSLWFLEYKEEYEKDLGMVFMACNLV 59 Score = 50.8 bits (116), Expect = 1e-06 Identities = 19/35 (54%), Positives = 28/35 (80%) Frame = +3 Query: 510 CNLITGMFQRLDKMRKQAFASVCLFGEDNNSTISG 614 CNL+ GM QRL+K+ K F S+C+FGE++N +I+G Sbjct: 56 CNLVGGMIQRLEKLVKNGFGSICIFGENHNCSIAG 90 >SB_21463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = -3 Query: 721 SSLERIQVSSSRRNS*STAKSDDSG-NTSSFPRHTHTPEMVELLSSPNRQTDAKACLRIL 545 SSL+ +Q + + S +G N P+H HTP+++ LS T+ C + Sbjct: 694 SSLDYVQRGKTPQRPWSMLIESPNGYNLPGSPKHAHTPQLITDLSRSASGTNLSRCSQKT 753 Query: 544 SNL 536 S+L Sbjct: 754 SSL 756 >SB_45563| Best HMM Match : TMS_TDE (HMM E-Value=2.2e-10) Length = 246 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 632 SAPHPHSGDGGIVVFTKQADGCESLFAHF 546 S PHP GDGG ++ + +G E ++ F Sbjct: 138 SRPHPRQGDGGKLLIEDELNGVEYSYSFF 166 >SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012) Length = 558 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +1 Query: 613 ECGCGAEKNSCSRCRLIWQWTTSSYDWKKLGSFRARRPRKFFQDYF-FVGTKPT 771 E G G K + WQ +DW+K +PR+FF+ + F+ +K T Sbjct: 364 ELGSGKAKKDAKK----WQRRAIKHDWRKQCEHLKEKPREFFKTFKPFLSSKNT 413 >SB_24051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 889 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 640 SSFPRHTHTPEMVELLSSPNRQTDAKACLR 551 S+ PR + E + LL P + DA+AC+R Sbjct: 413 SAIPRSRRSFESLPLLQQPTSRRDARACVR 442 >SB_38036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 Query: 684 LRLEETWILSSEETKKIFPRLLLRGNETDKKRVENFNPGQDISS 815 L TWI KKI PR+L RG++ + N PG + + Sbjct: 51 LTYNNTWI------KKIGPRILKRGSQRGETAYRNVEPGSQVKA 88 >SB_23539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1041 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 686 TTGRNLDPFERGDQENFSK-TTSSWERNRQKTGRK 787 T G+ D ++ K TT++W++ RQ TG+K Sbjct: 57 TLGKKHDKHSAKTRQTLGKNTTNTWQKTRQTTGKK 91 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,340,820 Number of Sequences: 59808 Number of extensions: 617451 Number of successful extensions: 1794 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1792 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -