SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30060
         (824 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_26182| Best HMM Match : Glycolytic (HMM E-Value=0)                 134   1e-31
SB_28080| Best HMM Match : Glycolytic (HMM E-Value=0)                 134   1e-31
SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26)                  33   0.28 
SB_26407| Best HMM Match : UQ_con (HMM E-Value=0)                      33   0.28 
SB_56456| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.65 
SB_59586| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.6  
SB_32406| Best HMM Match : VWA (HMM E-Value=8.8e-32)                   30   2.6  
SB_51968| Best HMM Match : PT (HMM E-Value=0.54)                       30   2.6  
SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12)              29   4.6  
SB_58036| Best HMM Match : Cadherin (HMM E-Value=0)                    29   4.6  
SB_24185| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-08)                 29   6.1  
SB_10368| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.1  
SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15)                   28   8.0  

>SB_26182| Best HMM Match : Glycolytic (HMM E-Value=0)
          Length = 949

 Score =  134 bits (323), Expect = 1e-31
 Identities = 69/124 (55%), Positives = 83/124 (66%), Gaps = 1/124 (0%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSE-DECTTQGL 442
           +S  ISGVILFHET+YQKADDGTP V LL  +GIIPGIKVDKGVV L G++  E TTQGL
Sbjct: 67  MSNAISGVILFHETVYQKADDGTPFVRLLRDQGIIPGIKVDKGVVVLAGTDAGETTTQGL 126

Query: 443 DDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCRLL 622
           D L +RCAQYKKDGC FAKWRC  +     P     ++    LAR    + +      ++
Sbjct: 127 DGLGERCAQYKKDGCDFAKWRCVLKITDYTPSELAMKENANVLARYA-SICQQNGLVPIV 185

Query: 623 KPEV 634
           +PEV
Sbjct: 186 EPEV 189



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/57 (82%), Positives = 52/57 (91%)
 Frame = +3

Query: 84  TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           TPEL+ ELK+IA+AIVA  KGILAADESTGTMGKRL +IGVENTEENRR YRQLLF+
Sbjct: 6   TPELKAELKRIAEAIVADGKGILAADESTGTMGKRLANIGVENTEENRRLYRQLLFT 62


>SB_28080| Best HMM Match : Glycolytic (HMM E-Value=0)
          Length = 304

 Score =  134 bits (323), Expect = 1e-31
 Identities = 69/124 (55%), Positives = 83/124 (66%), Gaps = 1/124 (0%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSE-DECTTQGL 442
           +S  ISGVILFHET+YQKADDGTP V LL  +GIIPGIKVDKGVV L G++  E TTQGL
Sbjct: 67  MSNAISGVILFHETVYQKADDGTPFVRLLRDQGIIPGIKVDKGVVVLAGTDAGETTTQGL 126

Query: 443 DDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCRLL 622
           D L +RCAQYKKDGC FAKWRC  +     P     ++    LAR    + +      ++
Sbjct: 127 DGLGERCAQYKKDGCDFAKWRCVLKITDYTPSELAMKENANVLARYA-SICQQNGLVPIV 185

Query: 623 KPEV 634
           +PEV
Sbjct: 186 EPEV 189



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 47/57 (82%), Positives = 52/57 (91%)
 Frame = +3

Query: 84  TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           TPEL+ ELK+IA+AIVA  KGILAADESTGTMGKRL +IGVENTEENRR YRQLLF+
Sbjct: 6   TPELKAELKRIAEAIVADGKGILAADESTGTMGKRLANIGVENTEENRRLYRQLLFT 62


>SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26)
          Length = 687

 Score = 33.1 bits (72), Expect = 0.28
 Identities = 23/69 (33%), Positives = 27/69 (39%), Gaps = 3/69 (4%)
 Frame = +1

Query: 301 RDPLPEG*RWNASGLPAGEEGHHPRHQGR---QGCRPAVRIGRRMHHPGSGRPRPALRPV 471
           R P   G   +  G P  E G  P   GR   +  RP   +GR  H PG     P   P 
Sbjct: 359 RPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPPHEPGRPPHEPGRLPH 418

Query: 472 QEGRLPLRQ 498
           + GR P  Q
Sbjct: 419 EPGRPPYEQ 427



 Score = 31.9 bits (69), Expect = 0.65
 Identities = 22/66 (33%), Positives = 25/66 (37%), Gaps = 3/66 (4%)
 Frame = +1

Query: 301 RDPLPEG*RWNASGLPAGEEGHHPRHQGR---QGCRPAVRIGRRMHHPGSGRPRPALRPV 471
           R P   G   +  G P  E G  P   GR   +  RP    GR  H PG     P   P 
Sbjct: 324 RPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPY 383

Query: 472 QEGRLP 489
           + GR P
Sbjct: 384 EPGRPP 389



 Score = 29.9 bits (64), Expect = 2.6
 Identities = 22/66 (33%), Positives = 25/66 (37%), Gaps = 3/66 (4%)
 Frame = +1

Query: 301 RDPLPEG*RWNASGLPAGEEGHHPRHQGR---QGCRPAVRIGRRMHHPGSGRPRPALRPV 471
           R P   G   +  G P  E G  P   GR   +  RP    GR  H PG     P   P 
Sbjct: 331 RPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPH 390

Query: 472 QEGRLP 489
           + GR P
Sbjct: 391 EPGRPP 396


>SB_26407| Best HMM Match : UQ_con (HMM E-Value=0)
          Length = 1282

 Score = 33.1 bits (72), Expect = 0.28
 Identities = 23/69 (33%), Positives = 27/69 (39%), Gaps = 3/69 (4%)
 Frame = +1

Query: 301 RDPLPEG*RWNASGLPAGEEGHHPRHQGR---QGCRPAVRIGRRMHHPGSGRPRPALRPV 471
           R P   G   +  G P  E G  P   GR   +  RP   +GR  H PG     P   P 
Sbjct: 125 RPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPPHEPGRPPHEPGRLPH 184

Query: 472 QEGRLPLRQ 498
           + GR P  Q
Sbjct: 185 EPGRPPYEQ 193



 Score = 31.9 bits (69), Expect = 0.65
 Identities = 22/66 (33%), Positives = 25/66 (37%), Gaps = 3/66 (4%)
 Frame = +1

Query: 301 RDPLPEG*RWNASGLPAGEEGHHPRHQGR---QGCRPAVRIGRRMHHPGSGRPRPALRPV 471
           R P   G   +  G P  E G  P   GR   +  RP    GR  H PG     P   P 
Sbjct: 90  RPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPY 149

Query: 472 QEGRLP 489
           + GR P
Sbjct: 150 EPGRPP 155



 Score = 29.9 bits (64), Expect = 2.6
 Identities = 22/66 (33%), Positives = 25/66 (37%), Gaps = 3/66 (4%)
 Frame = +1

Query: 301 RDPLPEG*RWNASGLPAGEEGHHPRHQGR---QGCRPAVRIGRRMHHPGSGRPRPALRPV 471
           R P   G   +  G P  E G  P   GR   +  RP    GR  H PG     P   P 
Sbjct: 97  RPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPH 156

Query: 472 QEGRLP 489
           + GR P
Sbjct: 157 EPGRPP 162


>SB_56456| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1266

 Score = 31.9 bits (69), Expect = 0.65
 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 3/92 (3%)
 Frame = +1

Query: 445 RPRPALRPVQEGRLPLRQVALLLKIGRNTPSYQAI-QENANVS-RPLT-LPSVRANAFVP 615
           R RP  RP    R+ + + AL  + G  T S  A+ + NANV+ +P + L S      +P
Sbjct: 519 RSRPTSRPA---RVSVTRSALRSRKGNRTLSLPALPRSNANVTQKPRSRLSSRHKTEALP 575

Query: 616 IVEARSLYLMGEARTLEPRPRKVNLKVVLGRP 711
            ++ +S     +A    P+P+K NLK V  +P
Sbjct: 576 KIKPQSRQSTAKA----PQPKKKNLKTVSMKP 603


>SB_59586| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 349

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKK 361
           +SG ++ +E L+Q  DD TPLV +L ++
Sbjct: 103 LSGSVVSNEWLHQLMDDSTPLVQILAER 130


>SB_32406| Best HMM Match : VWA (HMM E-Value=8.8e-32)
          Length = 1074

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 3/57 (5%)
 Frame = +1

Query: 328 WNASGLPAGEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGR---PRPALRPVQEGRLP 489
           W   G+P    G  P   GR G  P    G  +     G+   PRP +RP + GR+P
Sbjct: 515 WRPGGIPGRTPGRRPG--GRPGNIPPFVPGLIIPSRRPGKRPGPRPGIRPGRGGRIP 569


>SB_51968| Best HMM Match : PT (HMM E-Value=0.54)
          Length = 514

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 30/109 (27%), Positives = 42/109 (38%), Gaps = 1/109 (0%)
 Frame = +1

Query: 433 PGSGRPRPALRPVQEGRLPLRQVALLLKIGRNTPSYQAIQENANVSRPLTLPSVR-ANAF 609
           P + + RP  RP ++   PL       +  R TP     +      RP   P+ +     
Sbjct: 171 PTTIKRRPTERPTKKPTKPLLPEVEPEEEERATPRPTKAKPTTMKRRPTERPTKKPTKPL 230

Query: 610 VPIVEARSLYLMGEARTLEPRPRKVNLKVVLGRPVLKRPLKRTTKFLPP 756
           +P VE        E     PRP K     +  RP  +RP K+ TK L P
Sbjct: 231 LPEVEPE------EEEKATPRPTKAKPTTIKRRPT-ERPTKKPTKPLLP 272



 Score = 28.3 bits (60), Expect = 8.0
 Identities = 25/93 (26%), Positives = 37/93 (39%), Gaps = 1/93 (1%)
 Frame = +1

Query: 523 RNTPSYQAIQENANVSRPLTLPSVR-ANAFVPIVEARSLYLMGEARTLEPRPRKVNLKVV 699
           R TP     +  A + +P   P+ +     +P VE        E     PRP K     +
Sbjct: 324 RPTPRPTKAKPTAIIRKPTERPTKKPTKPLLPEVEPE------EEERATPRPTKAKPTTI 377

Query: 700 LGRPVLKRPLKRTTKFLPPRGKFLKAQNWLNGP 798
             RP  +RP K+ TK L P  +  + +    GP
Sbjct: 378 KRRPT-ERPTKKPTKPLLPEVESAEEERATPGP 409


>SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12)
          Length = 558

 Score = 29.1 bits (62), Expect = 4.6
 Identities = 19/44 (43%), Positives = 21/44 (47%), Gaps = 2/44 (4%)
 Frame = -1

Query: 779 WALRNF--PLGGKNLVVRLRGLFKTGRPRTTFKLTFLGRGSKVR 654
           W L NF  PL   N+V R     K GRPR  F     GR  +VR
Sbjct: 244 WLLSNFTCPLCMLNIVERDNSKKKPGRPRRWFSSLACGRCLRVR 287


>SB_58036| Best HMM Match : Cadherin (HMM E-Value=0)
          Length = 6074

 Score = 29.1 bits (62), Expect = 4.6
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = -3

Query: 468  WAQRWARSSRPWVVHSSSDPNSGTTPLSTLMPGMMPFFSSR 346
            WAQ ++ SS PW   S +   SGT   S+L   ++  +S +
Sbjct: 5909 WAQNYSSSSSPWAPSSPASVRSGTYS-SSLATDILDTYSQK 5948


>SB_24185| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-08)
          Length = 774

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 3/56 (5%)
 Frame = -1

Query: 335 AFHRQPSGKGSRGTGS--HQRCSRRAQRQAE*ELAITTTVLLCVLHADVL-QTLSH 177
           AFHR  +   S  + S  H R SRR +R++E +L + T  L+  +    L  T++H
Sbjct: 660 AFHRHATKVYSEQSTSEHHPRASRRRRRRSERQLTVVTLALVVFIVLFTLPSTVTH 715


>SB_10368| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 413

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 34/116 (29%), Positives = 49/116 (42%), Gaps = 5/116 (4%)
 Frame = +1

Query: 424 MHHPGSGRPRPALRPVQEGR-LP-LRQVALL--LKIGRNTPSYQAIQENANVSRPLTLPS 591
           MH   + RP PA+RP+   R LP +R V  +  L   R  P+ + +     +     LP+
Sbjct: 114 MHPLSAMRPLPAMRPLSAMRPLPAMRPVPAMRPLLAMRPLPAMRPLPAMRPLPAMRPLPA 173

Query: 592 VR-ANAFVPIVEARSLYLMGEARTLEPRPRKVNLKVVLGRPVLKRPLKRTTKFLPP 756
           +R   A  P+   R L  M     + P P    L  +  RPV   P  R    +PP
Sbjct: 174 MRPLPAMRPLPAMRPLPAMRPLSAMRPLPAMRPLPAI--RPV---PAMRPLPAMPP 224


>SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15)
          Length = 924

 Score = 28.3 bits (60), Expect = 8.0
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = -1

Query: 539 YEGVLRPIFSSNATWRSGSRPSCTGRSAGRGRPDPG 432
           Y+  LR   +S++TW  G       R +GRG  D G
Sbjct: 165 YDPTLRSRITSDSTWDRGENNDNNWRFSGRGDEDDG 200


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,295,550
Number of Sequences: 59808
Number of extensions: 674751
Number of successful extensions: 1906
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1685
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1893
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2311562737
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).