SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30055
         (803 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_26407| Best HMM Match : UQ_con (HMM E-Value=0)                      75   9e-14
SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   3e-05
SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.038
SB_18464| Best HMM Match : AFG1_ATPase (HMM E-Value=0.48)              32   0.63 
SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017)                 31   0.83 
SB_43766| Best HMM Match : RVT_1 (HMM E-Value=0.43)                    31   0.83 
SB_11801| Best HMM Match : DEAD (HMM E-Value=5e-05)                    31   1.4  
SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05)                 29   3.3  
SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11)             29   5.8  
SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05)                 29   5.8  
SB_37335| Best HMM Match : Sigma54_activat (HMM E-Value=7.8)           29   5.8  
SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07)                29   5.8  
SB_33407| Best HMM Match : UQ_con (HMM E-Value=0)                      29   5.8  
SB_19676| Best HMM Match : Ctr (HMM E-Value=3.1)                       29   5.8  
SB_53613| Best HMM Match : Sugar_tr (HMM E-Value=0.00012)              28   7.7  
SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37)                28   7.7  
SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.7  

>SB_26407| Best HMM Match : UQ_con (HMM E-Value=0)
          Length = 1282

 Score = 74.5 bits (175), Expect = 9e-14
 Identities = 47/112 (41%), Positives = 55/112 (49%), Gaps = 1/112 (0%)
 Frame = +2

Query: 365  SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPL 544
            SSA+RAL LE K L EEPVEGF V++  E N FEW+VAIFGPP TLY     +   + P 
Sbjct: 1123 SSAVRALQLELKKLTEEPVEGFTVEVPDESNTFEWDVAIFGPPGTLYAGGYFKAHMSFPH 1182

Query: 545  TTRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                      FLTK+W           + I  PP           P ERW P
Sbjct: 1183 DYPYSPPTFRFLTKMWHPNIYESGDVCISILHPPVDDP--QSGELPSERWNP 1232


>SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 473

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 20/63 (31%), Positives = 35/63 (55%)
 Frame = +2

Query: 404 LQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHHHPLGFLT 583
           LQ++PVEGF   L  +++L++WE+ + GPP T Y+    + +   P         L F++
Sbjct: 344 LQKKPVEGFSAGLFDDEDLYKWEIMVVGPPGTYYEEGYFKASMVFPKEYPQRPPTLTFIS 403

Query: 584 KVW 592
            +W
Sbjct: 404 DIW 406



 Score = 37.1 bits (82), Expect = 0.017
 Identities = 13/18 (72%), Positives = 17/18 (94%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNV++NG++CISILH P
Sbjct: 407 HPNVHKNGEVCISILHEP 424


>SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 385

 Score = 35.9 bits (79), Expect = 0.038
 Identities = 20/45 (44%), Positives = 26/45 (57%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           S A++ L  E K L+    E +  + L EDNLFEW   + GPPDT
Sbjct: 9   SPAVKRLMREAKELRNA-TELYHAQPL-EDNLFEWHFTVRGPPDT 51


>SB_18464| Best HMM Match : AFG1_ATPase (HMM E-Value=0.48)
          Length = 675

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 18/54 (33%), Positives = 28/54 (51%)
 Frame = +1

Query: 391 GVQESARRTCRRFPC*IARRGQSI*VGSGNLRTAGYTLSSGYFKAHMKFPPDYP 552
           G+++ A R  RR     A +G S+ +    LR  GY L+ G F+  +K   D+P
Sbjct: 417 GIRDEAPRNIRRALDLAAEKGSSVWLTVLPLREMGYNLNKGGFRDAIKLRYDWP 470


>SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017)
          Length = 123

 Score = 31.5 bits (68), Expect = 0.83
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = +2

Query: 452 DNLFEWEVAIFGPPDT 499
           DNLFEW   + GPPDT
Sbjct: 1   DNLFEWHFTVRGPPDT 16


>SB_43766| Best HMM Match : RVT_1 (HMM E-Value=0.43)
          Length = 491

 Score = 31.5 bits (68), Expect = 0.83
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +1

Query: 391 GVQESARRTCRRFPC*IARRGQSI*VGSGNLRTAGYTLSSGYFKAHMKFPPDYP 552
           G+++ A R   R     A +G S+ +    LR  GY L+ G F+  +K   D+P
Sbjct: 320 GIRDEAPRNIHRALALAAEKGSSVWLTVLPLREMGYNLNKGEFRDAIKLRYDWP 373


>SB_11801| Best HMM Match : DEAD (HMM E-Value=5e-05)
          Length = 1442

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +1

Query: 391 GVQESARRTCRRFPC*IARRGQSI*VGSGNLRTAGYTLSSGYFKAHMKFPPDYP 552
           GV++ A R   R     A +G S+ +    LR  GY L+ G F+  +K   D+P
Sbjct: 380 GVRDEAPRNIHRALDLAAEKGSSVWLKVLPLREMGYNLNKGEFRDAIKLRYDWP 433


>SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05)
          Length = 1604

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = -1

Query: 512 PLDKVYPAVRRLPLPTQIDCPLLAI*H 432
           PL++  PAV RLP P  ++ P+ A+ H
Sbjct: 479 PLERPVPAVTRLPTPLPLERPVPAVTH 505



 Score = 29.1 bits (62), Expect = 4.4
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = -1

Query: 512 PLDKVYPAVRRLPLPTQIDCPLLAI*H 432
           PL++  PAV RLP P  ++ P+ A+ H
Sbjct: 511 PLERPVPAVTRLPTPLLLERPVPAVTH 537


>SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11)
          Length = 3810

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 13/32 (40%), Positives = 15/32 (46%)
 Frame = +3

Query: 681 ANVGNPTQSVRNRYSPSGNLNPSKEPEHLSVP 776
           A V NPT  V     P+G+  PSK   H   P
Sbjct: 478 AKVPNPTDGVTGNVCPAGSYCPSKSQMHTPCP 509


>SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05)
          Length = 200

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 14/48 (29%), Positives = 24/48 (50%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           S+A + +  E   +  +P         G+D L+EW   I GPP ++Y+
Sbjct: 134 STAAKRIQRELTEITLDPPPNCSAGPKGDD-LYEWYSTILGPPGSVYE 180


>SB_37335| Best HMM Match : Sigma54_activat (HMM E-Value=7.8)
          Length = 206

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = +1

Query: 391 GVQESARRTCRRFPC*IARRGQSI*VGSGNLRTAGYTLSSGYFKAHMKFPPDYP 552
           G+ + A R   R     A +G S+ +    LR  GY L+ G F+  +K   D+P
Sbjct: 93  GIGDEAPRNIHRALDLAAEKGSSVWLTVLPLREMGYNLNKGEFRDAIKILYDWP 146


>SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07)
          Length = 181

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 10/26 (38%), Positives = 13/26 (50%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSI 570
           G     G F   + FP DYP+ PP +
Sbjct: 63  GSVYEGGVFFLDIHFPTDYPFKPPKV 88


>SB_33407| Best HMM Match : UQ_con (HMM E-Value=0)
          Length = 226

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 14/48 (29%), Positives = 24/48 (50%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           S+A + +  E   +  +P         G+D L+EW   I GPP ++Y+
Sbjct: 94  STAAKRIQRELTEITLDPPPNCSAGPKGDD-LYEWYSTILGPPGSVYE 140


>SB_19676| Best HMM Match : Ctr (HMM E-Value=3.1)
          Length = 311

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 8/15 (53%), Positives = 13/15 (86%)
 Frame = +2

Query: 689 WEPYTIGSQPVLPLW 733
           W P+++GS+ VLP+W
Sbjct: 34  WNPWSVGSKAVLPVW 48


>SB_53613| Best HMM Match : Sugar_tr (HMM E-Value=0.00012)
          Length = 466

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = -3

Query: 687 RSQGQFARLRIIPRAGGESICKDLRFHIHLDAQT 586
           RS G+F  +      GG+S+C +LR H + D +T
Sbjct: 289 RSAGEFRNIHFCIAIGGQSLC-ELRDHANTDHRT 321


>SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37)
          Length = 190

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 10/27 (37%), Positives = 14/27 (51%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSIR 573
           G     G FK  ++ P  YP+ PP +R
Sbjct: 7   GTPYHKGIFKLDIQIPERYPFEPPKVR 33


>SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 9/22 (40%), Positives = 15/22 (68%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRV 576
           G+F   ++ PPDYP  PP +++
Sbjct: 28  GFFYFLIRCPPDYPIRPPRVKL 49


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,295,484
Number of Sequences: 59808
Number of extensions: 661330
Number of successful extensions: 1770
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1414
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1749
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2227723674
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).