SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30049
         (727 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.)             109   2e-24
SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.)             107   9e-24
SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069)                   85   7e-17
SB_17563| Best HMM Match : DEAD (HMM E-Value=0)                        61   8e-10
SB_2247| Best HMM Match : DEAD (HMM E-Value=0)                         61   8e-10
SB_32980| Best HMM Match : DEAD (HMM E-Value=0)                        52   4e-07
SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38)                    51   8e-07
SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   8e-07
SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42)               48   6e-06
SB_43842| Best HMM Match : RNB (HMM E-Value=0)                         47   1e-05
SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40)              47   2e-05
SB_52320| Best HMM Match : DEAD (HMM E-Value=0)                        46   3e-05
SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19)                45   7e-05
SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41)                  44   2e-04
SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_9558| Best HMM Match : DEAD (HMM E-Value=0)                         41   9e-04
SB_3229| Best HMM Match : No HMM Matches (HMM E-Value=.)               41   0.001
SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36)                  40   0.002
SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17)                  39   0.004
SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.005
SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057)                   38   0.008
SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31)                  38   0.008
SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.)               37   0.019
SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.058
SB_57086| Best HMM Match : PT (HMM E-Value=2.4)                        30   1.7  
SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.7  
SB_9084| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.8  
SB_5942| Best HMM Match : Sec7 (HMM E-Value=3.1e-09)                   29   3.8  
SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.8  
SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.1  
SB_26341| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.1  
SB_37351| Best HMM Match : DEAD (HMM E-Value=0)                        28   6.7  
SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2)            28   6.7  
SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.7  
SB_33220| Best HMM Match : TP2 (HMM E-Value=1.7)                       28   6.7  
SB_22331| Best HMM Match : fn3 (HMM E-Value=7.1e-14)                   28   6.7  
SB_15811| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.7  
SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45)                   28   6.7  
SB_43963| Best HMM Match : Ammonium_transp (HMM E-Value=0)             28   8.9  
SB_5106| Best HMM Match : F5_F8_type_C (HMM E-Value=3.6e-31)           28   8.9  

>SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 370

 Score =  109 bits (263), Expect = 2e-24
 Identities = 49/67 (73%), Positives = 61/67 (91%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSIS+LQ IDT +RE QAL+L+PTRELA QIQKVV+ALGD+++ +CHACIGGTN+ 
Sbjct: 47  KTATFSISVLQAIDTQLREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIG 106

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 107 EDIRKLD 113



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/32 (87%), Positives = 30/32 (93%)
 Frame = +3

Query: 162 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           GFEKPSAIQQRAI P ++GRDVIAQAQSGTGK
Sbjct: 16  GFEKPSAIQQRAIKPILKGRDVIAQAQSGTGK 47



 Score = 32.3 bits (70), Expect = 0.41
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI        +IK+ VLDEADE
Sbjct: 124 GRVFDMIRRRNLRTRSIKMLVLDEADE 150


>SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 478

 Score =  107 bits (257), Expect = 9e-24
 Identities = 52/73 (71%), Positives = 63/73 (86%), Gaps = 6/73 (8%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE------CQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KTATF+ISILQ+IDT+ ++      CQAL+LAPTRELAQQIQKVV+ALGD+++ KCHACI
Sbjct: 135 KTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMHVKCHACI 194

Query: 416 GGTNVREDIRQLE 454
           GGTNVRED  +LE
Sbjct: 195 GGTNVREDRMKLE 207



 Score = 90.2 bits (214), Expect = 1e-18
 Identities = 51/84 (60%), Positives = 55/84 (65%), Gaps = 22/84 (26%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQ------------ 215
           G   ++WD+VVE+FDDMNLKE LLRGIYAYGFEKPSAIQQRAI PC Q            
Sbjct: 52  GKRQSNWDEVVESFDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQEFSPSHVCYNQL 111

Query: 216 ----------GRDVIAQAQSGTGK 257
                      RDVIAQAQSGTGK
Sbjct: 112 NLTKNHYVLSARDVIAQAQSGTGK 135



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 17/27 (62%), Positives = 19/27 (70%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI     +   IKLFVLDEADE
Sbjct: 218 GRVFDMINRGVLNTRDIKLFVLDEADE 244


>SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069)
          Length = 120

 Score = 84.6 bits (200), Expect = 7e-17
 Identities = 36/51 (70%), Positives = 47/51 (92%)
 Frame = +2

Query: 302 IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +RE QAL+L+PTRELA QIQKVV+ALGD+++ +CHACIGGTN+ EDIR+L+
Sbjct: 1   LREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIGEDIRKLD 51


>SB_17563| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 439

 Score = 61.3 bits (142), Expect = 8e-10
 Identities = 28/66 (42%), Positives = 44/66 (66%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA + + +L++ DT+    QAL+L PTRELA Q  ++ I LG H+ A+     GGT+++
Sbjct: 97  KTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGGTSLK 156

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 157 DDILRL 162



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GI+  GF+KPS IQ+ +I   + GRD++A+A++GTGK
Sbjct: 49  FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97


>SB_2247| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 439

 Score = 61.3 bits (142), Expect = 8e-10
 Identities = 28/66 (42%), Positives = 44/66 (66%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA + + +L++ DT+    QAL+L PTRELA Q  ++ I LG H+ A+     GGT+++
Sbjct: 97  KTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGGTSLK 156

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 157 DDILRL 162



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GI+  GF+KPS IQ+ +I   + GRD++A+A++GTGK
Sbjct: 49  FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97


>SB_32980| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 985

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS+  L+ + T     Q +IL PTRE+A Q++ V+ A+G H +   C   IGG ++
Sbjct: 63  KTCVFSVIALENVITESNCIQIIILTPTREIAVQVKDVICAIGCHYDGLACKVFIGGISL 122

Query: 431 REDIRQLE 454
            ED + L+
Sbjct: 123 EEDKKALK 130



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 27/49 (55%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L   LLRG+   GFEKPS IQ +AI     G D+IAQA+SGTGK
Sbjct: 15  FHSLLLSPTLLRGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGK 63


>SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38)
          Length = 475

 Score = 51.2 bits (117), Expect = 8e-07
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G D+I QA+SG GK
Sbjct: 49  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGK 97



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG N+
Sbjct: 97  KTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHKEYERFCKYMSNIKIAVFFGGINI 156

Query: 431 REDIRQLE 454
           ++D + L+
Sbjct: 157 KKDQQTLK 164


>SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 208

 Score = 51.2 bits (117), Expect = 8e-07
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G D+I QA+SG GK
Sbjct: 49  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGK 97



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG N+
Sbjct: 97  KTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHKEYERFCKYMSNIKIAVFFGGINI 156

Query: 431 REDIRQLE 454
           ++D + L+
Sbjct: 157 KKDQQTLK 164


>SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42)
          Length = 238

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 25/59 (42%), Positives = 35/59 (59%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KT  F++ ILQ +  + +   ALIL PTRELA QI +   ALG  +  KC   +GG ++
Sbjct: 14  KTGAFALPILQALLDNPQRLFALILTPTRELAFQISEQCEALGSGIGVKCAVIVGGIDM 72


>SB_43842| Best HMM Match : RNB (HMM E-Value=0)
          Length = 1238

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 2/80 (2%)
 Frame = +3

Query: 30  RIKVVTMDLREWTLG-HLH-TDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIM 203
           R+    +D   W  G H+   D  + +E+F D+NL  EL   +    F+ P+ IQ +++ 
Sbjct: 45  RLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKNFQVPTPIQMQSLS 104

Query: 204 PCIQGRDVIAQAQSGTGKLL 263
             + GRD+I  A++G+GK L
Sbjct: 105 CVMSGRDIIGLAETGSGKTL 124


>SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40)
          Length = 490

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 2/53 (3%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDV--IAQAQSGTGK 257
           ++F+++ L   L RG+Y  GF KPS IQ+ A+   +    V  IAQ+QSGTGK
Sbjct: 103 KSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLADPPVNMIAQSQSGTGK 155



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH 388
           KTA F +++L ++D +    Q + L+PT ELA+Q  KV  A+G H
Sbjct: 155 KTAAFVLTMLSRVDATKPYPQVICLSPTYELARQTGKVAEAMGKH 199


>SB_52320| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 340

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 22/57 (38%), Positives = 33/57 (57%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           VE F D  + +  L G+   GF  P+ IQ++ I   + GRDV+  A++G+GK L  L
Sbjct: 49  VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTLAFL 105



 Score = 37.9 bits (84), Expect = 0.008
 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 4/70 (5%)
 Frame = +2

Query: 254 KTATFSISILQ----QIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F I I++    Q  TS+    AL+++PTRELA Q  +V++ +G+  +      IGG
Sbjct: 100 KTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELAYQTFEVLVKIGNKHDLSAGLIIGG 159

Query: 422 TNVREDIRQL 451
            +++ + +++
Sbjct: 160 KDLKNEQKRI 169


>SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1170

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 20/52 (38%), Positives = 34/52 (65%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + +F++ NL E  L  +    ++KP+ +Q+ +I   I GRDV+A AQ+G+GK
Sbjct: 710 INSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGK 761



 Score = 35.1 bits (77), Expect = 0.058
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +2

Query: 314 QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           QA+ +APTRELA QI             +   C GG +V   +RQL+
Sbjct: 790 QAMCIAPTRELANQIYLEARKFAHGTMLRPVVCYGGVSVSHQLRQLQ 836


>SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19)
          Length = 185

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 20/52 (38%), Positives = 34/52 (65%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + +F++ NL E  L  +    ++KP+ +Q+ +I   I GRDV+A AQ+G+GK
Sbjct: 133 INSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGK 184


>SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1039

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F I + +++ T   +   +ALIL+PTRELA Q QK +  LG     K    +GG +
Sbjct: 331 KTAAFLIPMFEKLQTHTAKVGIRALILSPTRELALQTQKFIKELGRFTGLKSSVILGGDS 390

Query: 428 V 430
           V
Sbjct: 391 V 391


>SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1375

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 22/50 (44%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +3

Query: 111  FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG-RDVIAQAQSGTGK 257
            F+D++L E LL  +   G++KP+ +Q+ AI P ++G RD++A AQ+G+GK
Sbjct: 877  FEDVDLGEILLHNVGLAGYKKPTPVQKYAI-PIVKGKRDLMACAQTGSGK 925


>SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41)
          Length = 690

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+L PTRELAQQ+Q+V  ++G H   +     GG      IR+LE
Sbjct: 136 LVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELE 180


>SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1448

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 19/50 (38%), Positives = 33/50 (66%)
 Frame = +3

Query: 123 NLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           ++ E+ L+GI   GF   + IQ ++I P ++GRD++  A++G+GK L  L
Sbjct: 578 DVSEKTLQGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFL 627



 Score = 28.3 bits (60), Expect = 6.7
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +I++PTREL+ Q   V   L  H N      +GG N + +  +L+
Sbjct: 648 IIISPTRELSLQTYGVARDLLKHHNFTYGIIMGGVNRKAEAERLQ 692


>SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 797

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 17/52 (32%), Positives = 35/52 (67%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + +F+++   E+L+  I   G+ +P+ +Q+ A+   + GRD++A AQ+G+GK
Sbjct: 478 ITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGSGK 529



 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 5/72 (6%)
 Frame = +2

Query: 254 KTATFSISIL-----QQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KTA + + +L     Q ++   R   AL +APTRELA+QI        DH   K   C G
Sbjct: 529 KTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHTPIKVCVCYG 588

Query: 419 GTNVREDIRQLE 454
           G +V     QLE
Sbjct: 589 GVSVPYQASQLE 600


>SB_9558| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 436

 Score = 41.1 bits (92), Expect = 9e-04
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F  + L + L+    A G +KP+ IQ   + P +QGRD I  A++G+GK
Sbjct: 8   SFAGLGLNKWLVSQCVAMGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGK 57



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 24/76 (31%), Positives = 37/76 (48%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           C   +   + KTA F++ ILQ++        A++L PTRELA QI      LG  +  K 
Sbjct: 47  CIGCAKTGSGKTAAFALPILQKLCDDPYGIFAVVLTPTRELAFQIADQFKVLGRPIGLKE 106

Query: 404 HACIGGTNVREDIRQL 451
              +GG ++ +    L
Sbjct: 107 AVIVGGLDMMKQALSL 122


>SB_3229| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 45

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 16/22 (72%), Positives = 19/22 (86%)
 Frame = +2

Query: 389 LNAKCHACIGGTNVREDIRQLE 454
           ++ KCHACIGGTNVRED  +LE
Sbjct: 1   MHVKCHACIGGTNVREDRMKLE 22


>SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36)
          Length = 428

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           ALILAPTRELAQQI++ ++  G  L  +  + IGG +
Sbjct: 181 ALILAPTRELAQQIEEEILKFGRPLGIRTVSVIGGAD 217



 Score = 36.7 bits (81), Expect = 0.019
 Identities = 15/52 (28%), Positives = 32/52 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +  + +  + + +L  +   G++ P+ IQ++AI   +Q RD+I  A++G+GK
Sbjct: 100 IRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGK 151


>SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17)
          Length = 500

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 18/53 (33%), Positives = 30/53 (56%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLS 269
           F   +  E L + +  +G+  P+ IQ + +   + GRDV+  A +G+GKLL S
Sbjct: 198 FFHCSFNESLSKNLSNHGYHSPTPIQMQVLPVLLSGRDVMVCASTGSGKLLPS 250


>SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 697

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPC-IQGRDVIAQAQSGTGKLL 263
           ++ + +  ++LR +   GF KP+ IQ  +I P  +  RD+I  A++G+GK L
Sbjct: 132 WEGLGVAPDILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAETGSGKTL 183



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           ALI+APTRELA Q++  ++    + + K  A +GG    +  R L+
Sbjct: 221 ALIMAPTRELALQVKDHLVKAAKYTSVKVAAIVGGMAAPKQQRLLK 266


>SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057)
          Length = 96

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 20/55 (36%), Positives = 31/55 (56%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D+V+  +D ++ + E  R +   GF  P+ IQ   I   + G+DV A A +GTGK
Sbjct: 7   DEVLNAYDSLDEEAED-RAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGK 60


>SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31)
          Length = 978

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           Q V +F  + L++++L+ + A    +P+ IQ   I   I    VI  AQ+G+GK L  L
Sbjct: 375 QRVYSFAGLGLRDDVLKALDALNIHQPTVIQMVTIPKIIHRHHVICAAQTGSGKTLAYL 433



 Score = 29.1 bits (62), Expect = 3.8
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = +2

Query: 302 IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           ++  +A I+ P RELA QI K   +L  H   +    IGG
Sbjct: 453 LKRPRACIVVPARELATQILKTAKSLCHHARFRSVGLIGG 492


>SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 592

 Score = 36.7 bits (81), Expect = 0.019
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +2

Query: 305 RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           R+  A+++ PTRELA QI +         N +C    GGT + E I +L+
Sbjct: 143 RDMIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAELK 192



 Score = 35.9 bits (79), Expect = 0.033
 Identities = 18/59 (30%), Positives = 35/59 (59%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYR 278
           V+T+    ++ ++L  +    +EKP+ IQ +AI   + GRD+IA   + T +L + ++R
Sbjct: 104 VKTWAQTGVQLKILDVLKKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHR 162


>SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 790

 Score = 35.1 bits (77), Expect = 0.058
 Identities = 16/56 (28%), Positives = 31/56 (55%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLY 275
           +F      E+++  I    + +P+ IQ +A+   + GRD+I  A++G+GK    L+
Sbjct: 518 SFAHFGFDEQMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLW 573



 Score = 32.3 bits (70), Expect = 0.41
 Identities = 19/45 (42%), Positives = 21/45 (46%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           LI APTREL QQI       G   N    A  GG N  E  + L+
Sbjct: 594 LICAPTRELCQQIYTEARRFGKAYNIHVVAVFGGGNKYEQSKALQ 638


>SB_57086| Best HMM Match : PT (HMM E-Value=2.4)
          Length = 226

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 1/41 (2%)
 Frame = -3

Query: 497 YTRPWSAHHVHEH-HSPVGEYLHGHWCHQCKHGI*HSSDHQ 378
           YT P++  + H + H    +Y H  + HQC H   H   HQ
Sbjct: 175 YTHPYTHPYTHPYTHQYTHQYPH-QYTHQCTHQYTHQYTHQ 214



 Score = 28.7 bits (61), Expect = 5.1
 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%)
 Frame = -3

Query: 497 YTRPWSAHHVHEH-HSPVGEYLHGHWCHQCKHGI*HSSDHQELSP 366
           YT  ++  + H++ H    +Y H  + HQC H   H   H    P
Sbjct: 139 YTHQYTHQYTHQYTHQYTHQYTH-QYTHQCTHPYTHQYTHPYTHP 182



 Score = 27.9 bits (59), Expect = 8.9
 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%)
 Frame = -3

Query: 497 YTRPWSAHHVHEH-HSPVGEYLHGHWCHQCKHGI*HSSDHQ 378
           YT  ++ H+ H++ H    +Y H  + HQ  H   H   HQ
Sbjct: 2   YTHQYTHHYTHQYTHQYPHQYTH-QYTHQYPHQYPHQYTHQ 41



 Score = 27.9 bits (59), Expect = 8.9
 Identities = 12/40 (30%), Positives = 19/40 (47%)
 Frame = -3

Query: 497 YTRPWSAHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQ 378
           YT P++  + H++     +Y H  + HQ  H   H   HQ
Sbjct: 74  YTHPYTHPYTHQY---THQYTHHQYTHQYTHQYPHQYPHQ 110


>SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPC-IQGRDVIAQAQS 245
           ++ + +  ++LR +   GF KP+ IQ  +I P  +  RD+I  A++
Sbjct: 74  WEGLGVAPDILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAET 119


>SB_9084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELS 369
           HH H+HH    ++ H H  H  +H   H  DH  ++
Sbjct: 11  HHHHDHHHHDHQH-HDHQHHDHQHHDHHHHDHHHMT 45


>SB_5942| Best HMM Match : Sec7 (HMM E-Value=3.1e-09)
          Length = 304

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = -3

Query: 509 IIISYTRPWSAHHVHEHHSPVGEYLHGHWCHQCKH 405
           III  T   + HH H +H  +  + H HW H   H
Sbjct: 143 IIIIITIVIAIHHHHYYHHHLLHHHHHHWHHHHHH 177


>SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2851

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = -3

Query: 488 PWSAHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELS-PPS 360
           PW+  H  +H +P G+Y         +HG  H++   E + PPS
Sbjct: 479 PWNMQHPPQHRAPPGQYPPLGASPPVQHGRGHATGRGEFAGPPS 522


>SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 512

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 16/43 (37%), Positives = 25/43 (58%)
 Frame = +2

Query: 287 QIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           Q D++++E    IL    ELA++IQK++      LN K  AC+
Sbjct: 58  QGDSTLKEPVQKILIIGLELAKEIQKLIDEASSGLNIKHAACL 100


>SB_26341| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 329

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELSPP 363
           HH+   H   G   HGH  H+ +H   HSS +Q  +PP
Sbjct: 272 HHLEPEHEEHGHGGHGHGDHEREH---HSSQNQ--APP 304


>SB_37351| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 688

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 6/56 (10%)
 Frame = +2

Query: 254 KTATFSISILQQI-DTSI-----RECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           KT +F++ +++++ D  +     R  + L++APTRELA+Q+      L  +L   C
Sbjct: 123 KTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQVGNEFENLKSNLEVYC 178


>SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2)
          Length = 694

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 21/75 (28%), Positives = 30/75 (40%), Gaps = 8/75 (10%)
 Frame = -3

Query: 581 SGTTFSSASSRTKSLMVLA*KRTTII-------ISYTRPWSAH-HVHEHHSPVGEYLHGH 426
           S TT    ++ T +++++    TTII       + Y R    H H H HH     + H H
Sbjct: 172 SSTTIVVTTNNTITIIIITITSTTIITMPSPSIVIYRRHHQHHQHHHHHHHQHNHHHHHH 231

Query: 425 WCHQCKHGI*HSSDH 381
             H   H   H   H
Sbjct: 232 NHHHHHHHHYHHYHH 246


>SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 736

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 12/34 (35%), Positives = 14/34 (41%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQE 375
           HH H HH     + H H  H   H   H   HQ+
Sbjct: 258 HHHHHHHHQHNHHQHHHHHHHHHHN--HHHHHQQ 289


>SB_33220| Best HMM Match : TP2 (HMM E-Value=1.7)
          Length = 590

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 13/25 (52%), Positives = 15/25 (60%)
 Frame = -3

Query: 515 TTIIISYTRPWSAHHVHEHHSPVGE 441
           T III  T P + HH H HH P G+
Sbjct: 408 THIIIIIT-PLANHHSHHHHHPSGQ 431


>SB_22331| Best HMM Match : fn3 (HMM E-Value=7.1e-14)
          Length = 908

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 3/46 (6%)
 Frame = -2

Query: 597 WSLENLWNNIFISFIKNKKFDGVGMKAHDDYHII---YTTLECPPR 469
           W +E LW+N F   I ++  +G+  K  D + ++     ++EC PR
Sbjct: 69  WGVERLWSNTFELLIGDQS-NGLNPKCGDRHAVLPYDMISIECNPR 113


>SB_15811| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 248

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = -1

Query: 403 AFSIQVITKSYHHLLNLLGQLSCGSQDQSLTFTNACID 290
           A ++Q +TK+Y HL+N+ G      +++    T  C D
Sbjct: 201 AHALQTLTKAYRHLMNVTGN---RDKEEKANATEQCAD 235


>SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45)
          Length = 453

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 13/42 (30%), Positives = 18/42 (42%)
 Frame = -3

Query: 506 IISYTRPWSAHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDH 381
           I + T P+  HH H H      + H H  H+ +H   H   H
Sbjct: 300 ITTATPPYRYHHHHHHRHHHHHHHHHHQRHRHRHRHRHRHHH 341


>SB_43963| Best HMM Match : Ammonium_transp (HMM E-Value=0)
          Length = 730

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = -3

Query: 515 TTIIISYTRPWSAHHVHEH 459
           TTII++ ++P S HH H H
Sbjct: 556 TTIIVTSSKPLSHHHHHHH 574


>SB_5106| Best HMM Match : F5_F8_type_C (HMM E-Value=3.6e-31)
          Length = 445

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = -2

Query: 597 WSLENLWNNIFISFIKNKKFDGVGMKAHDDYHII---YTTLECPPR 469
           W +++LW+N F   I ++  +G+  K  D + ++     ++EC PR
Sbjct: 224 WGIQHLWSNTFELLIGDQS-NGLNPKCGDRHAVLPYDMISIECNPR 268


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,070,063
Number of Sequences: 59808
Number of extensions: 560562
Number of successful extensions: 2322
Number of sequences better than 10.0: 44
Number of HSP's better than 10.0 without gapping: 2026
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2279
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1937927537
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).