SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30047
         (794 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_20978| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.1  
SB_21363| Best HMM Match : Taeniidae_ag (HMM E-Value=0.52)             30   1.9  
SB_59638| Best HMM Match : HNF-1_N (HMM E-Value=0)                     29   3.3  
SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.3  
SB_786| Best HMM Match : EGF (HMM E-Value=0)                           29   4.3  
SB_56776| Best HMM Match : CRA_rpt (HMM E-Value=5.6e-17)               29   5.7  
SB_47381| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.7  
SB_35928| Best HMM Match : Transposase_9 (HMM E-Value=3.6)             29   5.7  
SB_24366| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.6  
SB_20837| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.6  
SB_22789| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.6  

>SB_20978| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1683

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 6/82 (7%)
 Frame = +1

Query: 67  YCKSEMAS---TATLIQPSGEL---WKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDE 228
           Y +SE  +   +  L+ P  EL   WK  R  L  D  T    L +++  L+K P L  E
Sbjct: 737 YSRSEQRALNKSCRLVDPGYELALLWKPDRPPLPNDYATALSRLESVERRLQKDPELAQE 796

Query: 229 WEDACLMTFSEAVASPLRNVKR 294
           ++ A      +  A  L + +R
Sbjct: 797 YKKAISAYVEKGFARKLSDEER 818


>SB_21363| Best HMM Match : Taeniidae_ag (HMM E-Value=0.52)
          Length = 328

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 2/101 (1%)
 Frame = +1

Query: 1   LRSPVRHLNRITKQLVPNWIVT--YCKSEMASTATLIQPSGELWKKIREELNEDVNTRAQ 174
           LR  VR +  + K  + N +      K  M  T  LI   G++ KKIREE  E       
Sbjct: 47  LREKVRKIVEVGKNALKNNVTQEEVWKEGMKKTNKLI---GDMKKKIREEFKEKQGL-GM 102

Query: 175 DLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRN 297
            +   K  + K  +  +E +   L  F+E + + ++N+K+N
Sbjct: 103 KIYRYKMHILKDMY--NEMKKHKLYEFAERIKAKIKNLKKN 141


>SB_59638| Best HMM Match : HNF-1_N (HMM E-Value=0)
          Length = 808

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 13/56 (23%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +1

Query: 133 IREELNEDVNTRAQDLAAIKEWL-RKQPHLPDEWEDACLMTFSEAVASPLRNVKRN 297
           + + LN+    ++Q  + + +W  RKQ  + D++ +     + + V SP +  +RN
Sbjct: 139 LSQHLNKGTPMKSQKRSVMYQWFERKQKEIADQYSNPGKRLYVDEVESPTKKSRRN 194


>SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3934

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 20/75 (26%), Positives = 38/75 (50%)
 Frame = +1

Query: 127  KKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRNLIC 306
            +K  EEL ED+      +A I+E  +KQ  +   W+    ++ +E+    LR+  ++L  
Sbjct: 3042 QKREEELQEDIKQMEDKIAIIEE--KKQEMVEKFWKSQNDLSEAESTIDSLRSENKDL-- 3097

Query: 307  TSR*GLLAQSSSRTE 351
             ++  L+ Q + R E
Sbjct: 3098 KNKCALITQRAERLE 3112


>SB_786| Best HMM Match : EGF (HMM E-Value=0)
          Length = 1427

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 2/75 (2%)
 Frame = +3

Query: 282  KCKKKLDMYFTMRAACPEFFANRDVTRPELMDL-LNRAQGPTLPGLTPQGRRVTIARALD 458
            +C+   ++  T R   P   A     RP++  L   R   PT P  TP  RR+ I     
Sbjct: 1347 RCRGHYEIPVTTRPLTPRRPAGYYFPRPQVTQLPRTRGTRPTTPVFTPSSRRIKIHPQTK 1406

Query: 459  KNL-DTNQLNDVFKL 500
            + L D  +L +   L
Sbjct: 1407 QELEDEKELAEALAL 1421


>SB_56776| Best HMM Match : CRA_rpt (HMM E-Value=5.6e-17)
          Length = 905

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 3/39 (7%)
 Frame = +3

Query: 135 PRGIE*GC---QHQGTGLSCNQGVAEKATPSTR*VGRRV 242
           PR +E  C    HQ + ++C QG   K+T S   +GR+V
Sbjct: 186 PRPLELTCTQGSHQKSKVTCTQGSYNKSTDSNEALGRKV 224


>SB_47381| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 96

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 5/56 (8%)
 Frame = -1

Query: 569 QYVNVSSLFPRLL---HAVLHLRYHCKFEDIIKLVR--VQVLVQCSGDGYSSTLRR 417
           Q++   S+  R+L   HA++ + YH + +D++KLV+   ++ VQ       STL R
Sbjct: 4   QFIRFGSVDVRVLDRHHALVAVAYHRRVKDLLKLVKKSKRISVQLYNPFLDSTLMR 59


>SB_35928| Best HMM Match : Transposase_9 (HMM E-Value=3.6)
          Length = 198

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 24/92 (26%), Positives = 44/92 (47%)
 Frame = -2

Query: 787 ALEKTLFSSIFSFKEWVLPMLKYDHPTKGEMR**TCISFQFHWISFLYTNERISSALLVK 608
           A+ K +F  + SFKEW L     +   + + +    + F F  +SF       +SAL V+
Sbjct: 41  AIRKDIFVVVQSFKEWTLCFEAKEMYLEDQNK--DLLIFDFR-MSFSAIITARASALFVR 97

Query: 607 SWRRWLGIRIEASST*TSPAYSLDFFTQSYIS 512
              + LG+R  + S+ +    +L   ++S +S
Sbjct: 98  QRYKQLGVRHTSDSSTSESMVNLREASESMVS 129


>SB_24366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 351

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 18/79 (22%), Positives = 34/79 (43%), Gaps = 4/79 (5%)
 Frame = +3

Query: 570 DASILMPSHLRQDF-TSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTH- 743
           + S+  P  +  D  T++ +E    +   ++    K  H      PF  WSY N    H 
Sbjct: 201 EPSVCDPQLVEADLATTNGDETFKRLQGTVVHIPTKSPHAITGCYPFAKWSYPNTENEHL 260

Query: 744 --SLKEKIEEKSVFSKAGC 794
             S+ + + E+ ++  +GC
Sbjct: 261 RYSIFKNLWERGLYITSGC 279


>SB_20837| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1304

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +1

Query: 49   PNWIVTYCKSEMASTATLIQPSGELWKKIREELNEDVNT 165
            P+  VTY KS   +T+ L+QPS      +  EL++ VNT
Sbjct: 995  PSINVTYVKSPSLTTSGLLQPSPS--ANVTTELSKPVNT 1031


>SB_22789| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 796

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 10/28 (35%), Positives = 19/28 (67%)
 Frame = -2

Query: 154 PHSIPRGFSSTVPRKAESGSPLMPSHFC 71
           P ++P+  ++T+PR + SG P +P+  C
Sbjct: 338 PPTLPKRGTATLPRTSSSGRPSIPTSRC 365


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,096,189
Number of Sequences: 59808
Number of extensions: 563351
Number of successful extensions: 1688
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1546
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1687
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2191792647
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).