SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30038
         (661 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)             184   6e-47
SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)              184   6e-47
SB_56| Best HMM Match : Actin (HMM E-Value=0)                         184   6e-47
SB_56628| Best HMM Match : Actin (HMM E-Value=0)                      184   6e-47
SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)              184   6e-47
SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)             137   6e-33
SB_54| Best HMM Match : Actin (HMM E-Value=0)                         105   4e-23
SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)             103   1e-22
SB_3885| Best HMM Match : Actin (HMM E-Value=0.77)                     94   8e-20
SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)             87   9e-18
SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)                  75   5e-14
SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)                  60   2e-09
SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)                 58   6e-09
SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10)                 54   8e-08
SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)               46   3e-05
SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   8e-05
SB_35006| Best HMM Match : PT (HMM E-Value=3.4)                        35   0.067
SB_43322| Best HMM Match : Peptidase_S9 (HMM E-Value=0.032)            33   0.21 
SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.63 
SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.63 
SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)                    31   0.63 
SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)                  31   0.63 
SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.5  
SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.5  
SB_7573| Best HMM Match : Nucleoporin (HMM E-Value=0.21)               30   1.5  
SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12)                 30   1.5  
SB_27518| Best HMM Match : RWD (HMM E-Value=0.015)                     30   1.5  
SB_33399| Best HMM Match : Ank (HMM E-Value=0)                         29   4.4  
SB_35177| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_28336| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_19560| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_11299| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_40626| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.7  

>SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score =  184 bits (448), Expect = 6e-47
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  139 bits (336), Expect = 2e-33
 Identities = 65/71 (91%), Positives = 67/71 (94%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           M D+E+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 43/46 (93%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 153 VMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERG 198


>SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score =  184 bits (448), Expect = 6e-47
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNSPAMYVAIQAVLSLYASGRTTGI 151



 Score =  136 bits (329), Expect = 1e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 8e-21
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>SB_56| Best HMM Match : Actin (HMM E-Value=0)
          Length = 375

 Score =  184 bits (448), Expect = 6e-47
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNSPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 6e-33
 Identities = 64/69 (92%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           ++EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 8e-21
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>SB_56628| Best HMM Match : Actin (HMM E-Value=0)
          Length = 376

 Score =  184 bits (448), Expect = 6e-47
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  143 bits (347), Expect = 1e-34
 Identities = 66/71 (92%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 97.5 bits (232), Expect = 8e-21
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 349

 Score =  184 bits (448), Expect = 6e-47
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  139 bits (336), Expect = 2e-33
 Identities = 63/71 (88%), Positives = 67/71 (94%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           M D+++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 17/21 (80%), Positives = 19/21 (90%), Gaps = 2/21 (9%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYE--GYA 565
           V+DSGDGVSHTVPIYE  GY+
Sbjct: 153 VMDSGDGVSHTVPIYEERGYS 173


>SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 338

 Score =  137 bits (332), Expect = 6e-33
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D++VAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 43/46 (93%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 115 VMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERG 160



 Score = 64.5 bits (150), Expect = 7e-11
 Identities = 30/37 (81%), Positives = 34/37 (91%)
 Frame = +3

Query: 399 NREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           N + M +IMFETFN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 78  NWDDMEKIMFETFNSPAMYVAIQAVLSLYASGRTTGI 114



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 21/24 (87%), Positives = 21/24 (87%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTF 326
           LKYPIEHGIVTNWDDMEKI   TF
Sbjct: 67  LKYPIEHGIVTNWDDMEKIMFETF 90


>SB_54| Best HMM Match : Actin (HMM E-Value=0)
          Length = 2486

 Score =  105 bits (251), Expect = 4e-23
 Identities = 47/67 (70%), Positives = 57/67 (85%)
 Frame = +3

Query: 306  KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
            K+W H F ++LRV  E+ PVLLTEAPLNPK NRE+M Q+MFE+FN P MYVA+QAV++LY
Sbjct: 2130 KMWEHAF-DQLRVRGEDFPVLLTEAPLNPKMNRERMVQLMFESFNVPCMYVAVQAVMALY 2188

Query: 486  ASGRTTG 506
            ASGRTTG
Sbjct: 2189 ASGRTTG 2195



 Score = 78.2 bits (184), Expect = 6e-15
 Identities = 33/46 (71%), Positives = 39/46 (84%)
 Frame = +2

Query: 509  VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
            V D GDGVSHTVP+Y+GY LPHA  R+DLAGRDLT YL +++TERG
Sbjct: 2197 VFDCGDGVSHTVPVYDGYWLPHATQRIDLAGRDLTHYLQRLVTERG 2242



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/34 (67%), Positives = 30/34 (88%)
 Frame = +1

Query: 79   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 180
            +V+DNGSG CKAG + D++PR VFP+IVGRPRH+
Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRPRHK 2130


>SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 411

 Score =  103 bits (248), Expect = 1e-22
 Identities = 47/93 (50%), Positives = 66/93 (70%), Gaps = 2/93 (2%)
 Frame = +3

Query: 237 QKRYP-DLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREK 410
           Q RY  ++ YP+++GIV NWDDM+ +W +TF  +++ + P    VLLTE PLNP  NREK
Sbjct: 63  QLRYMLEVNYPMDNGIVRNWDDMKHVWDYTFGESKMNIDPRNTKVLLTEPPLNPMKNREK 122

Query: 411 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           M ++MFE +    +Y+AIQAVL+LYA G  TG+
Sbjct: 123 MIEVMFENYQFEGVYIAIQAVLTLYAQGLLTGV 155



 Score = 71.3 bits (167), Expect = 6e-13
 Identities = 29/46 (63%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H  P+YEG+ALPH   RLD+AGRD+T YL+K++  RG
Sbjct: 156 VIDSGDGVTHICPVYEGFALPHLTRRLDIAGRDITKYLIKLMLLRG 201



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 2/67 (2%)
 Frame = +1

Query: 73  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRG 246
           + +V DNG+G  K G+AG + P  +FPS+VGRP  R    +  +  KD  VGDEA   R 
Sbjct: 7   SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRPIIRSSQKVGDIEVKDLMVGDEASQLRY 66

Query: 247 ILTSNTP 267
           +L  N P
Sbjct: 67  MLEVNYP 73


>SB_3885| Best HMM Match : Actin (HMM E-Value=0.77)
          Length = 152

 Score = 94.3 bits (224), Expect = 8e-20
 Identities = 42/46 (91%), Positives = 44/46 (95%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V DSGDGVSH VPIYEGYALPHAILRLDLAGRDLTDYLMK++TERG
Sbjct: 31  VFDSGDGVSHNVPIYEGYALPHAILRLDLAGRDLTDYLMKLMTERG 76



 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 26/30 (86%), Positives = 29/30 (96%)
 Frame = +3

Query: 420 IMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           IMFE FN+PA+YVAIQAVLSLYASGRTTG+
Sbjct: 1   IMFEAFNSPAVYVAIQAVLSLYASGRTTGV 30


>SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)
          Length = 367

 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 36/52 (69%), Positives = 47/52 (90%)
 Frame = +3

Query: 354 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           +HPVLLTEAPLNP+ NREK  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 126 QHPVLLTEAPLNPRRNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 177



 Score = 71.3 bits (167), Expect = 6e-13
 Identities = 29/46 (63%), Positives = 40/46 (86%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLD+GDGVSH+VPIYEG+A+PH+I+R D+AGRD++ YL  +L + G
Sbjct: 178 VLDAGDGVSHSVPIYEGFAMPHSIMRTDIAGRDVSRYLRLLLRKEG 223


>SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)
          Length = 240

 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 30/82 (36%), Positives = 54/82 (65%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           PI+ G++ +WD  EKI  + +   ++     HP+L++EA  N +  REK+T++MFE +N 
Sbjct: 3   PIKDGMIEDWDLFEKILDYIYSKNIKSDSALHPLLMSEAAWNTRIKREKLTELMFEKYNV 62

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PA ++   +VL+ +A+GR+ G+
Sbjct: 63  PAFFLCKNSVLTAFANGRSNGL 84



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           V+DSG   +  VP+++GY L  AI+R  LAG  +T    ++  E     +P
Sbjct: 85  VIDSGATQTSAVPVHDGYVLQQAIVRSPLAGDFITAQCRQMFEETNVEVIP 135


>SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)
          Length = 1392

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 27/39 (69%), Positives = 29/39 (74%)
 Frame = +1

Query: 64   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 180
            E    LV+D GS M K GFAGDDAP+ VFP IVGRPRHQ
Sbjct: 1354 EAPTPLVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQ 1392


>SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)
          Length = 921

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 3/76 (3%)
 Frame = +1

Query: 43  Y*FKMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKD-S 213
           Y FK+      A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G  +  KD  
Sbjct: 691 YSFKLDSHYNRAIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIGDNVNVKDYK 750

Query: 214 YVGDEAQSKRGILTSN 261
             GD A +K G++  N
Sbjct: 751 KYGDAAVAKSGVMHLN 766


>SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10)
          Length = 543

 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 21/45 (46%), Positives = 33/45 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L ER
Sbjct: 65  VIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITFFVQQLLRER 109


>SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)
          Length = 372

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 18/38 (47%), Positives = 23/38 (60%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 371
           K+PI H IV +WD ME+ W    +  LR  PE+H  LL
Sbjct: 299 KWPIRHAIVEDWDLMERFWEQCIFKYLRAEPEDHYFLL 336



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 9/14 (64%), Positives = 13/14 (92%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPI 550
           V+DSGDGV+H +P+
Sbjct: 359 VIDSGDGVTHVIPV 372


>SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 22/39 (56%), Positives = 28/39 (71%)
 Frame = -2

Query: 177 MAGPSDDRGEYGARSIISCETGLAHTGAIVYYQRGNFLV 61
           MA  +DD GE G+ SI+S ETGLAHTGAI+  Q  + +V
Sbjct: 1   MARSADDGGENGSGSIVSGETGLAHTGAIIDNQSCDIIV 39


>SB_35006| Best HMM Match : PT (HMM E-Value=3.4)
          Length = 325

 Score = 34.7 bits (76), Expect = 0.067
 Identities = 16/38 (42%), Positives = 25/38 (65%)
 Frame = -3

Query: 272 FDGVFEVRIPLLLCASSPTYESFCPMPTITP*WRGLPT 159
           +DGV ++++ LLL +SSP + S  P+   TP  +GL T
Sbjct: 273 YDGVIDIKLNLLLLSSSPMFLSAVPIAPHTPTLQGLHT 310


>SB_43322| Best HMM Match : Peptidase_S9 (HMM E-Value=0.032)
          Length = 216

 Score = 33.1 bits (72), Expect = 0.21
 Identities = 15/41 (36%), Positives = 20/41 (48%)
 Frame = +2

Query: 437 QHARHVRRHPSRALAVRVRSYHRYVLDSGDGVSHTVPIYEG 559
           QH RHV    S     ++ S  +YV D  D +   +P YEG
Sbjct: 25  QHERHVGHGKSEGERAQIDSLQKYVRDIFDHIDQIIPKYEG 65


>SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 220

 Score = 31.5 bits (68), Expect = 0.63
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP--EEHPVLLTEAPLNPKANRE 407
           L+ P +  +VT+++  E++  H F +     P    HPV++TE   NP   R+
Sbjct: 131 LRTPFDRDVVTHYECQEQVLDHAFSHLGINTPGGVNHPVIMTEPVCNPNYCRQ 183


>SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 31.5 bits (68), Expect = 0.63
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -3

Query: 152 GNTARGASSPAKPALHIPEPLSTT 81
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)
          Length = 170

 Score = 31.5 bits (68), Expect = 0.63
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -3

Query: 152 GNTARGASSPAKPALHIPEPLSTT 81
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)
          Length = 580

 Score = 31.5 bits (68), Expect = 0.63
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
 Frame = +3

Query: 234 EQKRYPDLKY--PIEHGIVTNWDDMEKIWHHTFYNE 335
           E K Y  L Y  P + G + NWD  ++IW +TF  E
Sbjct: 280 ECKDYSALFYVLPFQKGFLVNWDVEKQIWDYTFGKE 315



 Score = 27.9 bits (59), Expect = 7.7
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAV 147
           ++A LV+D G+   K GFA + APR++
Sbjct: 232 KMATLVLDCGACSQKIGFASNQAPRSI 258


>SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 749

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = -3

Query: 152 GNTARGASSPAKPALHIPEPLSTT 81
           GNT R    PAKP+L++P P S T
Sbjct: 540 GNTNRRTRIPAKPSLNLPSPPSKT 563


>SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 724

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
 Frame = +1

Query: 505 VCAGLRRRCLPHRTH-LRGIRTPSRHPASGLGRSRPHRLPHEDPHRARYSFT 657
           +C+ L    +    H L+ +  PS   +  L + RP  LPH   +RA  SFT
Sbjct: 666 ICSKLFDEIVSDPNHKLKSLLPPSNVSSHNLRKKRPFALPHLKTNRAMNSFT 717


>SB_7573| Best HMM Match : Nucleoporin (HMM E-Value=0.21)
          Length = 928

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 5/70 (7%)
 Frame = -3

Query: 263 VFEVRIPLLLCASS-PTYESFC----PMPTITP*WRGLPTIEGNTARGASSPAKPALHIP 99
           VF VR+P+L+C SS  T+   C        IT   + L  I  ++A+  S P++P    P
Sbjct: 375 VFPVRLPMLVCVSSVVTHVGVCFQHQCYKCITDCLQRLLAIRQSSAQSPSLPSRPG---P 431

Query: 98  EPLSTTNAAT 69
            P    NA T
Sbjct: 432 PPTPDPNALT 441


>SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12)
          Length = 642

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
 Frame = +1

Query: 505 VCAGLRRRCLPHRTH-LRGIRTPSRHPASGLGRSRPHRLPHEDPHRARYSFT 657
           +C+ L    +    H L+ +  PS   +  L + RP  LPH   +RA  SFT
Sbjct: 584 ICSKLFDEIVSDPNHKLKSLLPPSNVSSHNLRKKRPFALPHLKTNRAMNSFT 635


>SB_27518| Best HMM Match : RWD (HMM E-Value=0.015)
          Length = 277

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 9/15 (60%), Positives = 13/15 (86%)
 Frame = +1

Query: 460 PSKPCSRCTRPVVPP 504
           P++PCS CT+P +PP
Sbjct: 220 PTEPCSLCTKPALPP 234


>SB_33399| Best HMM Match : Ank (HMM E-Value=0)
          Length = 1416

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 15/37 (40%), Positives = 18/37 (48%)
 Frame = -3

Query: 266  GVFEVRIPLLLCASSPTYESFCPMPTITP*WRGLPTI 156
            G     +P    A+SP Y S  P+PT TP     PTI
Sbjct: 1210 GALFTPLPHETSATSPPYTSASPVPTTTPSASSSPTI 1246


>SB_35177| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1293

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 20/48 (41%), Positives = 29/48 (60%)
 Frame = +3

Query: 408  KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGMCWTPATVSPTPYPS 551
            K ++I+ E +   A+  + QA  S Y+S  TT M  TP+ +SPTP PS
Sbjct: 1109 KTSKILMENYK--AVPKSAQAP-SPYSSS-TTKMTGTPSPMSPTPSPS 1152


>SB_28336| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/45 (26%), Positives = 24/45 (53%)
 Frame = +3

Query: 384 LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGMCWT 518
           + PK    ++  ++F  F  P M +A++    + A+G  TG+ +T
Sbjct: 174 ITPKRATSQIIFVLFCIFGLPVMMLALKTAGDIIAAGLKTGIIFT 218


>SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = -3

Query: 152 GNTARGASSPAKPALHIPEPLSTT 81
           GNT R     AKPAL++P P S T
Sbjct: 40  GNTNRRTRIQAKPALNLPSPPSKT 63


>SB_19560| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 3/71 (4%)
 Frame = +1

Query: 430 KHSTRPPCTSPSKPCSRCTRPVVPPVC--AGLRRRCLPH-RTHLRGIRTPSRHPASGLGR 600
           + +T  PC++   PCS    P     C   G  R  L H R  L   R    H    LG 
Sbjct: 35  RSATLAPCSATLAPCSATLAPCSALTCPMLGHTRPTLGHTRPTLGHTRPTLGHTRPMLGH 94

Query: 601 SRPHRLPHEDP 633
           +RP  L H  P
Sbjct: 95  TRP-MLGHTHP 104


>SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 635

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = -3

Query: 152 GNTARGASSPAKPALHIPEPLSTT 81
           GNT R    PAKP L IP P + T
Sbjct: 68  GNTNRRTRIPAKPTLTIPSPPTKT 91


>SB_11299| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3762

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +3

Query: 492 GRTTGMCWTPATVSPTPYPSTRDTHSLTPSCVW 590
           G+TTG  + PA+ SP    +     ++TP   W
Sbjct: 853 GQTTGTQFAPASASPAAAAAAAAASAITPQSFW 885


>SB_40626| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 979

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +3

Query: 192 RHGTERLVRRRRGT---EQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELR 341
           ++ TE  + R R     ++KRY +L   ++    T+ +D+ K+W    Y E R
Sbjct: 55  KYKTEEALNRSRAYLEFQRKRYGNLYQLLKGNTFTDAEDLVKLWDAAHYEEER 107


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,055,880
Number of Sequences: 59808
Number of extensions: 603799
Number of successful extensions: 2357
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 2009
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2346
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1693527500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).