SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30036
         (699 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21)         103   1e-22
SB_22837| Best HMM Match : REJ (HMM E-Value=0.057)                     33   0.22 
SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.7  
SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.7  
SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.8  
SB_8499| Best HMM Match : DUF229 (HMM E-Value=0)                       29   4.8  
SB_59024| Best HMM Match : 7tm_1 (HMM E-Value=5.2e-19)                 29   4.8  
SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17)               29   4.8  

>SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21)
          Length = 147

 Score =  103 bits (247), Expect = 1e-22
 Identities = 49/81 (60%), Positives = 61/81 (75%)
 Frame = +1

Query: 325 TLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHTQVRAIRKKMCEIITRDVTN 504
           TLIEA +DVKTTDGY+LR+FCIGFT +     +KT YA+HTQ++AIRKKM +IITR+V+ 
Sbjct: 2   TLIEAAVDVKTTDGYLLRMFCIGFTKRRQNQIKKTAYAKHTQIKAIRKKMVDIITREVST 61

Query: 505 SDSGRW*TS*FPDSIAKDIEK 567
           +D         PDSI KDIEK
Sbjct: 62  NDLKEVVNKLIPDSIGKDIEK 82



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 24/51 (47%), Positives = 29/51 (56%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV   KVKVLK+  F +I KL+
Sbjct: 64  LKEVVNKLIPD-SIGKDIEKSCQSIYPLHDVHIRKVKVLKKPKF-DIGKLM 112


>SB_22837| Best HMM Match : REJ (HMM E-Value=0.057)
          Length = 643

 Score = 33.1 bits (72), Expect = 0.22
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 7/58 (12%)
 Frame = +3

Query: 180 IYKLTLTR-KGLSANSD*SPNMCKDVCALQLPRHGPH------NR*AQVDG*KMADSH 332
           ++KLT+T  KGL+ +   + N+ KDV    + R GP       NR A++DG K +D H
Sbjct: 306 VFKLTVTDDKGLTGSGTVAVNVKKDVNQAPVARAGPDVVVHLPNRAAELDGSKSSDDH 363


>SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 561

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 16/60 (26%), Positives = 26/60 (43%)
 Frame = -1

Query: 219 LRKDLSASVSACRSARETSKTLPFNPSEAIFVPWVRLTSVVPTCLLLNIDGALTSYQSLR 40
           LRK L    S  +  RE  + L FNP E+ +V            L + ++  +   +SL+
Sbjct: 302 LRKQLIDMASVAKDLREIDELLKFNPDESAYVLQAESLKKANNVLQIELEELIKKEKSLK 361


>SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1974

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 11/30 (36%), Positives = 21/30 (70%)
 Frame = +2

Query: 158  VFEVSLADLQADTDAERSFRKFRLIAEYVQ 247
            +F  + +D+QA+++    FR+F L+ EYV+
Sbjct: 1176 IFNNTFSDVQANSNQIWKFRRFELVMEYVE 1205


>SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 311

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +2

Query: 23  IVDPFTRKDWYDVKAPSMFSKRQ 91
           +V+P+  KDW D    SMFS RQ
Sbjct: 98  LVEPWRWKDWEDFTQSSMFSGRQ 120


>SB_8499| Best HMM Match : DUF229 (HMM E-Value=0)
          Length = 926

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 14/32 (43%), Positives = 16/32 (50%)
 Frame = -1

Query: 339 GFDESLPFFNHPPELIGCEVHAVEVAEHIRPC 244
           G    +  FN  P+  GCE  A  VAEH  PC
Sbjct: 747 GLKRGMSMFNEIPKTRGCE--AAGVAEHYCPC 776


>SB_59024| Best HMM Match : 7tm_1 (HMM E-Value=5.2e-19)
          Length = 423

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 3/41 (7%)
 Frame = +3

Query: 3   KKVLRRRLSTHSL---AKIGTMSRLRLCSARGKSAPRLSTV 116
           KK+LRR+LS  S    +  G  SRLR C +    + R+ +V
Sbjct: 374 KKILRRQLSDSSFRSRSSSGFASRLRYCGSNQSESSRVQSV 414


>SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17)
          Length = 1775

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 12/40 (30%), Positives = 17/40 (42%)
 Frame = +2

Query: 206 RSFRKFRLIAEYVQGRMCSATSTAWTSQPISSGGWLKNGR 325
           R++ K  LI     G      +  W   P++  GW  NGR
Sbjct: 22  RTWHKAELIPPQWPGAQGQLRTVTWHGSPVTRNGWTWNGR 61


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,410,154
Number of Sequences: 59808
Number of extensions: 514723
Number of successful extensions: 1510
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1393
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1510
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1829596184
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).