SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30031
         (567 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_36131| Best HMM Match : His_leader (HMM E-Value=2.7e-10)            33   0.12 
SB_5068| Best HMM Match : DED (HMM E-Value=1.5e-17)                    32   0.28 
SB_51387| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  
SB_27983| Best HMM Match : PAN (HMM E-Value=0.0022)                    29   3.5  
SB_48266| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.6  
SB_45722| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.1  
SB_16073| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.1  
SB_49938| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.1  

>SB_36131| Best HMM Match : His_leader (HMM E-Value=2.7e-10)
          Length = 416

 Score = 33.5 bits (73), Expect = 0.12
 Identities = 19/78 (24%), Positives = 42/78 (53%)
 Frame = +3

Query: 117 SSQSIIRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHHHETRQYIMETSLNMKI 296
           SS SII   + H H +   S  ++ +  HH  P+  ++ +++HHH    +   +S ++ I
Sbjct: 255 SSSSIII--IIHHHHHPSSSSSIIIIIHHHHHPSSSSSIIIIHHH----HHPSSSSSIII 308

Query: 297 MMLIPNMHLNTKSKTLTL 350
           +++I + H  + S ++ +
Sbjct: 309 IIIIHHHHHPSSSSSIII 326



 Score = 32.7 bits (71), Expect = 0.22
 Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 4/61 (6%)
 Frame = +3

Query: 117 SSQSIIRHD----VTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHHHETRQYIMETSL 284
           SS SII H     + H H +    +H   +  HH +  IH    ++HH  +    + +SL
Sbjct: 336 SSSSIIHHHPSSIIIHHHPSSSIIHHPSSIIHHHPSSIIHHPSSIIHHPSSSSSSLSSSL 395

Query: 285 N 287
           +
Sbjct: 396 S 396



 Score = 31.1 bits (67), Expect = 0.66
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 7/62 (11%)
 Frame = +3

Query: 117 SSQSIIRHDVTHGHGNEGQSYHVVPVAAHHGAPT-----IHAAP--VLVHHHETRQYIME 275
           SS SII   + H H +   S  ++ +  HH  P+     IH  P  +++HHH +   I  
Sbjct: 302 SSSSIIIIIIIHHHHHPSSSSSIIIIIHHHHHPSSSSSIIHHHPSSIIIHHHPSSSIIHH 361

Query: 276 TS 281
            S
Sbjct: 362 PS 363



 Score = 28.7 bits (61), Expect = 3.5
 Identities = 12/44 (27%), Positives = 22/44 (50%)
 Frame = +3

Query: 120 SQSIIRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHHH 251
           S SII   + H H +   S  ++ +  HH   +  +  +++HHH
Sbjct: 239 SSSIIIIIIIHHHHHPSSSSIIIIIHHHHHPSSSSSIIIIIHHH 282



 Score = 27.5 bits (58), Expect = 8.1
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = +3

Query: 117 SSQSIIRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHHH 251
           SS  II H   H H +   S  ++ +  HH  P+  ++ +++ HH
Sbjct: 288 SSSIIIIHH--HHHPSSSSSIIIIIIIHHHHHPSSSSSIIIIIHH 330


>SB_5068| Best HMM Match : DED (HMM E-Value=1.5e-17)
          Length = 786

 Score = 32.3 bits (70), Expect = 0.28
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +3

Query: 282 LNMKIMMLIPNMHLNTKSKTLTLGT*RANT--RLATVMS*RATTLCMK-LMDLSVLWNTP 452
           LN+    L P + ++  S +L   T  A     L T  S   T L ++ L+D S+L   P
Sbjct: 343 LNISFCRLSPELQIDLISLSLYPTTFVAADVYYLLTDHSELTTQLHLQDLVDNSLLQFDP 402

Query: 453 PSKHNGFNAVVQAHCSDKA-AEPVQQYYHH*KRFY 554
            SK    + V+QA C DKA ++  +  Y H K+ +
Sbjct: 403 VSKQYAMHGVIQAFCMDKARSKDFELSYQHAKKVF 437


>SB_51387| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 214

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = +2

Query: 287 YEDYDAHPKYAFEYKIEDPHTGDLKSQHE 373
           Y+ YD + KY F +K  DP+  D+    E
Sbjct: 140 YDKYDKYDKYDFPWKAIDPNLPDMPEDKE 168


>SB_27983| Best HMM Match : PAN (HMM E-Value=0.0022)
          Length = 616

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 19/71 (26%), Positives = 35/71 (49%)
 Frame = +3

Query: 174 SYHVVPVAAHHGAPTIHAAPVLVHHHETRQYIMETSLNMKIMMLIPNMHLNTKSKTLTLG 353
           ++HVV + A+    TI A  V V       +++    N+ ++++  N+H+ T     T+ 
Sbjct: 280 NFHVVTIRANLHEVTIRA-DVHVVTIRGNLHVVTIRANLHVVIIRANLHVVTIRANSTVP 338

Query: 354 T*RANTRLATV 386
             RAN  L T+
Sbjct: 339 IIRANLHLVTI 349


>SB_48266| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 723

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -2

Query: 329 CIQMHIWDEHHNLHIEAGLHDVLARFMVMHEHGCSV 222
           C    +W   +++  E  LHDV+A +++  EH  +V
Sbjct: 26  CPVSAVWLPRNSMRRECPLHDVIAHYVMHDEHPANV 61


>SB_45722| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1080

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = +2

Query: 263  VHHGDQPQYEDYDAHPKYAFEYKIEDPHTGD 355
            V  GD    ++Y A+   A+ Y +EDP T D
Sbjct: 1046 VTDGDHISDDEYRAYEDGAYTYPVEDPFTDD 1076


>SB_16073| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 238

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 4/59 (6%)
 Frame = -2

Query: 356 GPQCEGLRFCIQMHIWDEHHNLHIEAGLHDVL----ARFMVMHEHGCSVYSRSSMMRCY 192
           GP   G    I+  + DEHHNL  EA   D+     A   V  ++GC   S    ++ Y
Sbjct: 10  GPVGAGKTSAIRA-LCDEHHNLETEAKASDITGLRKATTTVAMDYGCLTLSDGEAVQLY 67


>SB_49938| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 882

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 13/50 (26%), Positives = 23/50 (46%)
 Frame = -2

Query: 368 VGSSGPQCEGLRFCIQMHIWDEHHNLHIEAGLHDVLARFMVMHEHGCSVY 219
           + +S  +C+GLR  +    +   H  +I + LH  L  F       CS++
Sbjct: 594 LSASDTKCKGLRKTVNFDAFAHAHVHYIASRLHPGLINFEYFASGNCSIH 643


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,476,162
Number of Sequences: 59808
Number of extensions: 364003
Number of successful extensions: 1260
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1077
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1244
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1337207630
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).