SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30027
         (765 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.)             180   1e-45
SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.)             179   3e-45
SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069)                  105   5e-23
SB_17563| Best HMM Match : DEAD (HMM E-Value=0)                        78   9e-15
SB_2247| Best HMM Match : DEAD (HMM E-Value=0)                         78   9e-15
SB_32980| Best HMM Match : DEAD (HMM E-Value=0)                        74   1e-13
SB_3229| Best HMM Match : No HMM Matches (HMM E-Value=.)               73   2e-13
SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42)               67   1e-11
SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40)              67   2e-11
SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   4e-11
SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41)                  64   2e-10
SB_9558| Best HMM Match : DEAD (HMM E-Value=0)                         59   4e-09
SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38)                    59   4e-09
SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   2e-07
SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   7e-07
SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   1e-06
SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8)                      50   2e-06
SB_37351| Best HMM Match : DEAD (HMM E-Value=0)                        50   3e-06
SB_52320| Best HMM Match : DEAD (HMM E-Value=0)                        48   6e-06
SB_37968| Best HMM Match : DEAD (HMM E-Value=3.6)                      47   1e-05
SB_59075| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19)            46   3e-05
SB_55073| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19)            46   3e-05
SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   3e-05
SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17)                  46   3e-05
SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36)                  41   0.001
SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31)                  40   0.003
SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.047
SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27)                  35   0.062
SB_54977| Best HMM Match : MFS_1 (HMM E-Value=0.006)                   35   0.062
SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27)            33   0.25 
SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22)            32   0.58 
SB_4002| Best HMM Match : Galactosyl_T (HMM E-Value=3.1e-24)           30   1.8  
SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057)                   30   2.3  
SB_9272| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   2.3  
SB_58206| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.3  
SB_43842| Best HMM Match : RNB (HMM E-Value=0)                         30   2.3  
SB_25218| Best HMM Match : zf-AD (HMM E-Value=0.094)                   29   3.1  
SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17)                  29   3.1  
SB_2863| Best HMM Match : Asp (HMM E-Value=1.2e-07)                    29   3.1  
SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.4  
SB_15811| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.2  

>SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 370

 Score =  180 bits (437), Expect = 1e-45
 Identities = 104/214 (48%), Positives = 136/214 (63%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSIS+LQ IDT +RE QAL+L+PTRELA QIQKVV+ALGD+++ +CHACIGGTN+
Sbjct: 46  GKTATFSISVLQAIDTQLREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNI 105

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G H+V GTPGRV+DMI   R + T S     +K++     +     M++  
Sbjct: 106 GEDIRKLDYGQHIVSGTPGRVFDMIR-RRNLRTRS-----IKML----VLDEADEMLNKG 155

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL----------YAYLYRRKSLPWKVLNN-FT 507
           F + ++  Y  L P   +         EIL             L +R  L  + +   F 
Sbjct: 156 FKEQIYDVYRYLPPATQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFV 215

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            +E EEWK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 216 AVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKV 249



 Score =  116 bits (280), Expect = 2e-26
 Identities = 69/169 (40%), Positives = 99/169 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L   +IK+ VLDEADEML++GFK+QI+DV++ L    QV+LLSAT+P ++LE++  F
Sbjct: 132 RRNLRTRSIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLLSATLPHEILEMTSKF 191

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           M DP+RILV+++ELTLEGIKQF++   R     +++  +  T+  T      +  +    
Sbjct: 192 MTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDW 251

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDM Q+E E IMK        V   +TD+WARG
Sbjct: 252 LTEKMREANFTVASMHGDMPQKEREAIMKDFRAGQSRVL-ISTDVWARG 299



 Score = 31.9 bits (69), Expect = 0.58
 Identities = 12/19 (63%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTV++MHG
Sbjct: 250 DWLTEKMREANFTVASMHG 268


>SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 478

 Score =  179 bits (435), Expect = 3e-45
 Identities = 107/213 (50%), Positives = 139/213 (65%), Gaps = 10/213 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE------CQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKTATF+ISILQ+IDT+ ++      CQAL+LAPTRELAQQIQKVV+ALGD+++ KCHAC
Sbjct: 134 GKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMHVKCHAC 193

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-T 339
           IGGTNVRED  +LE GVHVVVGTPGRV+DMI     + T    LF+  L +    +SR  
Sbjct: 194 IGGTNVREDRMKLEEGVHVVVGTPGRVFDMI-NRGVLNTRDIKLFV--LDEADEMLSRGF 250

Query: 340 RSMMSSRFCQLMFKSYYSLLPCLMM--YWKYLDAL*EILYAYLYRRKSLPWKVLNN-FTC 510
           +  +   F +L       LL   M     +  +     +   L +R+ +  + +   F  
Sbjct: 251 KDQIYDVFTRLPTSVQVVLLSATMPTDVLEVTNKFMRDVVRILVKREEVTLEGIKQFFVL 310

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           +E E+WKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 311 VEKEDWKLDTLCDLYETLTITQAVIFANTRRKV 343



 Score =  122 bits (295), Expect = 2e-28
 Identities = 61/84 (72%), Positives = 70/84 (83%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R  L+   IKLFVLDEADEMLSRGFKDQI+DVF  L   VQV+LLSATMP DVLEV+  F
Sbjct: 226 RGVLNTRDIKLFVLDEADEMLSRGFKDQIYDVFTRLPTSVQVVLLSATMPTDVLEVTNKF 285

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           MRD VRILV++EE+TLEGIKQF++
Sbjct: 286 MRDVVRILVKREEVTLEGIKQFFV 309



 Score = 29.5 bits (63), Expect = 3.1
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)
 Frame = +2

Query: 533 WKLCVTCMIH--CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           WKL   C ++    + +    A    + DWL   M  +D TVS+MHG
Sbjct: 316 WKLDTLCDLYETLTITQAVIFANTRRKVDWLAAKMTEKDHTVSSMHG 362


>SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069)
          Length = 120

 Score =  105 bits (251), Expect = 5e-23
 Identities = 45/65 (69%), Positives = 58/65 (89%)
 Frame = +1

Query: 52  IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGT 231
           +RE QAL+L+PTRELA QIQKVV+ALGD+++ +CHACIGGTN+ EDIR+L+ G H+V GT
Sbjct: 1   LREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIGEDIRKLDYGQHIVSGT 60

Query: 232 PGRVY 246
           PGRV+
Sbjct: 61  PGRVF 65


>SB_17563| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 439

 Score = 77.8 bits (183), Expect = 9e-15
 Identities = 64/218 (29%), Positives = 106/218 (48%), Gaps = 13/218 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA + + +L++ DT+    QAL+L PTRELA Q  ++ I LG H+ A+     GGT++
Sbjct: 96  GKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGGTSL 155

Query: 181 REDIRQLESG-------VHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRT 339
           ++DI +L +        VHV+V TPGRV D  L+ + +   S    L+       E  + 
Sbjct: 156 KDDILRLYNKDIFVHVVVHVIVATPGRVLD--LMKKKLADMSKCQMLV-----MDEADKL 208

Query: 340 RSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYL---YRRKSLPWKVLNNFT- 507
            SM   +  + + K        L+    +  ++ +    +L   Y    +    L+  T 
Sbjct: 209 LSMDFKKMLEQIIKHLPENRQILLFSATFPISVRDFKEKHLRKPYEINLMDELTLHGVTQ 268

Query: 508 --CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
                 E+ K+  L  L+  L I Q++IFCN+ ++V L
Sbjct: 269 YYAFVEEKQKVHCLNTLFQKLQINQSIIFCNSVQRVEL 306



 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 28/74 (37%), Positives = 44/74 (59%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           ++ V+DEAD++LS  FK  +  + K L  + Q++L SAT P  V +     +R P  I +
Sbjct: 198 QMLVMDEADKLLSMDFKKMLEQIIKHLPENRQILLFSATFPISVRDFKEKHLRKPYEINL 257

Query: 465 QKEELTLEGIKQFY 506
             +ELTL G+ Q+Y
Sbjct: 258 M-DELTLHGVTQYY 270


>SB_2247| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 439

 Score = 77.8 bits (183), Expect = 9e-15
 Identities = 64/218 (29%), Positives = 106/218 (48%), Gaps = 13/218 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA + + +L++ DT+    QAL+L PTRELA Q  ++ I LG H+ A+     GGT++
Sbjct: 96  GKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGGTSL 155

Query: 181 REDIRQLESG-------VHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRT 339
           ++DI +L +        VHV+V TPGRV D  L+ + +   S    L+       E  + 
Sbjct: 156 KDDILRLYNKDIFVHVVVHVIVATPGRVLD--LMKKKLADMSKCQMLV-----MDEADKL 208

Query: 340 RSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYL---YRRKSLPWKVLNNFT- 507
            SM   +  + + K        L+    +  ++ +    +L   Y    +    L+  T 
Sbjct: 209 LSMDFKKMLEQIIKHLPENRQILLFSATFPISVRDFKEKHLRKPYEINLMDELTLHGVTQ 268

Query: 508 --CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
                 E+ K+  L  L+  L I Q++IFCN+ ++V L
Sbjct: 269 YYAFVEEKQKVHCLNTLFQKLQINQSIIFCNSVQRVEL 306



 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 28/74 (37%), Positives = 44/74 (59%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           ++ V+DEAD++LS  FK  +  + K L  + Q++L SAT P  V +     +R P  I +
Sbjct: 198 QMLVMDEADKLLSMDFKKMLEQIIKHLPENRQILLFSATFPISVRDFKEKHLRKPYEINL 257

Query: 465 QKEELTLEGIKQFY 506
             +ELTL G+ Q+Y
Sbjct: 258 M-DELTLHGVTQYY 270


>SB_32980| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 985

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 39/102 (38%), Positives = 62/102 (60%), Gaps = 1/102 (0%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS+  L+ + T     Q +IL PTRE+A Q++ V+ A+G H +   C   IGG +
Sbjct: 62  GKTCVFSVIALENVITESNCIQIIILTPTREIAVQVKDVICAIGCHYDGLACKVFIGGIS 121

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLM 303
           + ED + L+S  H+ VGTPGRV   ++  +++ T S  +F++
Sbjct: 122 LEEDKKALKS-CHIAVGTPGRV-KYLIEQKYLKTESVRMFIL 161



 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 21/77 (27%), Positives = 46/77 (59%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ L   ++++F+LDEAD++L   F+ QI+ +F  L  + Q++  SAT P+ +    + +
Sbjct: 148 QKYLKTESVRMFILDEADKLLDESFQQQINWIFSALPENKQMMAFSATYPEVLANHLKKY 207

Query: 438 MRDPVRILVQKEELTLE 488
           M +P  + +   + +L+
Sbjct: 208 MTEPTFVRLNAADPSLQ 224


>SB_3229| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 45

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 31/39 (79%), Positives = 35/39 (89%)
 Frame = +1

Query: 139 LNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           ++ KCHACIGGTNVRED  +LE GVHVVVGTPGRV+DMI
Sbjct: 1   MHVKCHACIGGTNVREDRMKLEEGVHVVVGTPGRVFDMI 39


>SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42)
          Length = 238

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 33/83 (39%), Positives = 47/83 (56%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ ILQ +  + +   ALIL PTRELA QI +   ALG  +  KC   +GG ++
Sbjct: 13  GKTGAFALPILQALLDNPQRLFALILTPTRELAFQISEQCEALGSGIGVKCAVIVGGIDM 72

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                 L    H+++ TPGR+ D
Sbjct: 73  MSQALMLAKKPHIIIATPGRLID 95


>SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40)
          Length = 490

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 60/209 (28%), Positives = 100/209 (47%), Gaps = 8/209 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F +++L ++D +    Q + L+PT ELA+Q  KV  A+G H  + K +  + G  
Sbjct: 154 GKTAAFVLTMLSRVDATKPYPQVICLSPTYELARQTGKVAEAMGKHCPHIKINYAVRGNQ 213

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVR-FMPTP-SNFLF----LMKLMKCCPEVSRT 339
                R  +   H+++GTPG + D I   + F P   S F+     +M  ++   + S  
Sbjct: 214 FP---RGQKCTDHIIIGTPGTLLDWIRKSKCFEPRKVSVFVLDEADIMIALQGHQDQSIR 270

Query: 340 RSMMSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIE 516
                 + CQ L+F + Y     +M + +    +   +   L R +     +   +   +
Sbjct: 271 IHKSLHKDCQVLLFSATYD--EDVMKFAE--TVVPNPIIIRLRREEESLDNIKQYYVVCK 326

Query: 517 LEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
             E K E LC++Y  LSI Q V+FC+TRR
Sbjct: 327 NSEDKFEALCNMYGVLSIGQCVVFCHTRR 355



 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 31/77 (40%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           + +FVLDEAD M++ +G +DQ   + K L  D QV+L SAT  +DV++ +   + +P+ I
Sbjct: 247 VSVFVLDEADIMIALQGHQDQSIRIHKSLHKDCQVLLFSATYDEDVMKFAETVVPNPIII 306

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE +L+ IKQ+Y+
Sbjct: 307 RLRREEESLDNIKQYYV 323


>SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 797

 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 37/90 (41%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISIL-----QQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA + + +L     Q ++   R   AL +APTRELA+QI        DH   K   C 
Sbjct: 528 GKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHTPIKVCVCY 587

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG +V     QLE G H +VGTPGR+ D +
Sbjct: 588 GGVSVPYQASQLERGCHFLVGTPGRLQDFV 617



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 4/67 (5%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFK----ILSADVQVILLSATMPDDVLE 422
           +R  ++  +I+  +LDEAD ML  GF   IH + +          Q ++ SAT PD++  
Sbjct: 618 SREKIYLGSIQHLILDEADRMLDLGFGPDIHKLIEESNMTAKESRQTLMFSATFPDEIQH 677

Query: 423 VSRCFMR 443
           ++  F++
Sbjct: 678 LAGSFLK 684


>SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41)
          Length = 690

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 28/62 (45%), Positives = 39/62 (62%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L PTRELAQQ+Q+V  ++G H   +     GG      IR+LE GV + + TPGR+ D
Sbjct: 136 LVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELERGVEICIATPGRLID 195

Query: 250 MI 255
           M+
Sbjct: 196 ML 197



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 26/63 (41%), Positives = 35/63 (55%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V  ++  F+ D V I V   
Sbjct: 211 VLDEADRMLDMGFEPQIRTIIDQIRPDRQTLMWSATWPKEVQGLAHDFLSDYVHITVGSL 270

Query: 474 ELT 482
            LT
Sbjct: 271 GLT 273


>SB_9558| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 436

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 33/85 (38%), Positives = 47/85 (55%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F++ ILQ++        A++L PTRELA QI      LG  +  K    +GG ++
Sbjct: 56  GKTAAFALPILQKLCDDPYGIFAVVLTPTRELAFQIADQFKVLGRPIGLKEAVIVGGLDM 115

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
            +    L +  HVV+ TPGR+ D I
Sbjct: 116 MKQALSLANKPHVVIATPGRLADHI 140



 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 25/81 (30%), Positives = 40/81 (49%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L+   I+  VLDEAD +L   F D +  +F  +    Q +L SAT+ D + E+ +     
Sbjct: 146 LNLKKIQFLVLDEADRLLDPSFGDDLKVIFDAVPEKRQTLLFSATLTDTMGELQKMSGSQ 205

Query: 447 PVRILVQKEELTLEGIKQFYM 509
           P    VQ +  T+  + Q Y+
Sbjct: 206 PFSYEVQSDIATVAELDQRYL 226


>SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38)
          Length = 475

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 32/83 (38%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG N
Sbjct: 96  GKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHKEYERFCKYMSNIKIAVFFGGIN 155

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D + L++   H+VVGTPGR+
Sbjct: 156 IKKDQQTLKTNCPHIVVGTPGRI 178


>SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 208

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 32/83 (38%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG N
Sbjct: 96  GKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHKEYERFCKYMSNIKIAVFFGGIN 155

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D + L++   H+VVGTPGR+
Sbjct: 156 IKKDQQTLKTNCPHIVVGTPGRI 178


>SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1170

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1    GKTATFSISILQQI------DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKC 153
            GKTA F + ++  +       +S  E Q   A+ +APTRELA QI             + 
Sbjct: 760  GKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARKFAHGTMLRP 819

Query: 154  HACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
              C GG +V   +RQL+SG +++VGTPGR+ D I
Sbjct: 820  VVCYGGVSVSHQLRQLQSGCNLLVGTPGRLTDFI 853



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 4/77 (5%)
 Frame = +3

Query: 282  IKLFVLDEADEMLSRGFKDQIHDVFKIL----SADVQVILLSATMPDDVLEVSRCFMRDP 449
            ++  +LDEAD ML  GF+  I  + + +     ++ Q ++ SAT P+++  ++  F+ D 
Sbjct: 863  LQFLILDEADRMLDMGFEPAIRRIVESMGMPDKSERQTLMFSATFPEEIQRLAGDFLNDY 922

Query: 450  VRILVQKEELTLEGIKQ 500
            + + V +   T   I+Q
Sbjct: 923  LFLTVGRVGGTTSDIEQ 939


>SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 592

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 26/67 (38%), Positives = 39/67 (58%)
 Frame = +1

Query: 55  RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTP 234
           R+  A+++ PTRELA QI +         N +C    GGT + E I +L+ G  ++V TP
Sbjct: 143 RDMIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAELKRGAEIIVCTP 202

Query: 235 GRVYDMI 255
           GR+ DM+
Sbjct: 203 GRMIDML 209



 Score = 37.1 bits (82), Expect = 0.015
 Identities = 27/103 (26%), Positives = 43/103 (41%), Gaps = 8/103 (7%)
 Frame = +3

Query: 216 CGGGHSRSCI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQI-----HDVFKILSA--- 371
           C  G     +  +  R  +       VLDEAD M   GF+ QI       V +I+     
Sbjct: 200 CTPGRMIDMLTANNGRVTNCQRCTYLVLDEADRMFDMGFEPQITKIRYPKVMRIIDCIRP 259

Query: 372 DVQVILLSATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQ 500
           D Q ++ SAT P  +  ++R  +  P+ I V    +    ++Q
Sbjct: 260 DRQTVMFSATFPRQMEALARKILDKPIEIQVGGRSVVCSDVEQ 302


>SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 790

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 34/90 (37%), Positives = 44/90 (48%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFS----ISILQQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F     + I+ Q +  + +    LI APTREL QQI       G   N    A  
Sbjct: 566 GKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIHVVAVF 625

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG N  E  + L+ G  +VV TPGR+ D +
Sbjct: 626 GGGNKYEQSKALQEGAEIVVATPGRLIDHV 655


>SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1448

 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 29/89 (32%), Positives = 56/89 (62%), Gaps = 3/89 (3%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           +T+  L+ N ++  V+DEAD +L  GF++++  + +IL +  Q +L SAT   +V ++++
Sbjct: 711 NTQGFLYKN-LQCLVIDEADRILEIGFEEEMRQIIRILPSKRQTVLFSATQTKNVEDLAK 769

Query: 432 CFM-RDPVRILV--QKEELTLEGIKQFYM 509
             + R P+ + V   KE  T+EG++Q Y+
Sbjct: 770 LSLKRSPLYVGVDDHKETSTVEGLEQGYI 798



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 4/87 (4%)
 Frame = +1

Query: 1   GKTATFSISILQ---QIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F + +++   ++    R     +I++PTREL+ Q   V   L  H N      +G
Sbjct: 621 GKTLAFLVPVVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVARDLLKHHNFTYGIIMG 680

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYD 249
           G N + +  +L+ GV++++ TPGR+ D
Sbjct: 681 GVNRKAEAERLQKGVNLLIATPGRLLD 707


>SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 697

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 24/63 (38%), Positives = 39/63 (61%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           ALI+APTRELA Q++  ++    + + K  A +GG    +  R L+    +VV TPGR++
Sbjct: 221 ALIMAPTRELALQVKDHLVKAAKYTSVKVAAIVGGMAAPKQQRLLKQRPEIVVATPGRLW 280

Query: 247 DMI 255
           ++I
Sbjct: 281 ELI 283



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 7/82 (8%)
 Frame = +3

Query: 255 TRRALHANTIKLF---VLDEADEMLSRGFKDQIHDVFKIL----SADVQVILLSATMPDD 413
           T +  H + I+L    V+DEAD M+ +G  +++  + +++    S +++V    A  P +
Sbjct: 328 TNQEKHVSNIQLLRYLVIDEADRMVEQGHYEELSSILELIHLKKSGNMEVDQEDAERPSN 387

Query: 414 VLEVSRCFMRDPVRILVQKEEL 479
                R   R+   ILVQK  L
Sbjct: 388 SSSEKRYIQRN---ILVQKSSL 406


>SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8)
          Length = 210

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 4/66 (6%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQ---VILLSATMP-DDVLEVSRC 434
           L   +IK+ VLDEADEML++GFK+QI+DV++ L    Q   V  L  ++P  + L  + C
Sbjct: 31  LDTRSIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQNSYVEYLHESVPKSEPLSSNSC 90

Query: 435 FMRDPV 452
              DP+
Sbjct: 91  SPGDPL 96


>SB_37351| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 688

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQI-DTSI-----RECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT +F++ +++++ D  +     R  + L++APTRELA+Q+      L  +L   C   
Sbjct: 122 GKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQVGNEFENLKSNLEVYC--I 179

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GG         + SG+ V+VGTPGR+ D +
Sbjct: 180 YGGMPYEPQENAINSGLDVLVGTPGRILDFM 210


>SB_52320| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 340

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 4/85 (4%)
 Frame = +1

Query: 1   GKTATFSISILQ----QIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F I I++    Q  TS+    AL+++PTRELA Q  +V++ +G+  +      IG
Sbjct: 99  GKTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELAYQTFEVLVKIGNKHDLSAGLIIG 158

Query: 169 GTNVREDIRQLESGVHVVVGTPGRV 243
           G +++ + +++    ++VV TPGR+
Sbjct: 159 GKDLKNEQKRIMK-TNIVVCTPGRL 182



 Score = 38.3 bits (85), Expect = 0.007
 Identities = 18/58 (31%), Positives = 35/58 (60%)
 Frame = +3

Query: 279 TIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPV 452
           ++++ VLDEAD +L  GF   ++ + + L ++ Q +L SAT    V +++R  ++  V
Sbjct: 196 SLQILVLDEADRILDMGFAPTLNAIIENLPSERQTLLYSATQTRSVKDLARLSLQSYV 253


>SB_37968| Best HMM Match : DEAD (HMM E-Value=3.6)
          Length = 127

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 25/73 (34%), Positives = 38/73 (52%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +++ VLDEAD ML  GF   I  V   L A  Q +L SAT  DD+  ++   + +P+ I 
Sbjct: 4   VEILVLDEADRMLDMGFIHDIRRVLTKLPAKRQNLLFSATFSDDIKALAEKLLHNPLEIE 63

Query: 462 VQKEELTLEGIKQ 500
           V +     + + Q
Sbjct: 64  VARRNTASDQVLQ 76


>SB_59075| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19)
          Length = 445

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           +  VLDEAD M+  GF++ +  +F    +  Q +L SATMP  +   ++  +  PV + V
Sbjct: 18  RYLVLDEADRMIDMGFEEDVRTIFSYFKSQRQTLLFSATMPKKIQNFAKSALVKPVTVNV 77


>SB_55073| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19)
          Length = 212

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           +  VLDEAD M+  GF++ +  +F    +  Q +L SATMP  +   ++  +  PV + V
Sbjct: 18  RYLVLDEADRMIDMGFEEDVRTIFSYFKSQRQTLLFSATMPKKIQNFAKSALVKPVTVNV 77


>SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1039

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 26/62 (41%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F I + +++ T   +   +ALIL+PTRELA Q QK +  LG     K    +GG 
Sbjct: 330 GKTAAFLIPMFEKLQTHTAKVGIRALILSPTRELALQTQKFIKELGRFTGLKSSVILGGD 389

Query: 175 NV 180
           +V
Sbjct: 390 SV 391


>SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17)
          Length = 500

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 25/85 (29%), Positives = 43/85 (50%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           +R+A+    +   V+DE D ML  GF+ Q+  + + LS   Q +L SAT+P  +  ++  
Sbjct: 271 SRQAVDLTHVIGCVVDEVDTMLQLGFEQQVQQILERLSNRRQTMLFSATIPPSIEAMASR 330

Query: 435 FMRDPVRILVQKEELTLEGIKQFYM 509
            +  PV I      L  + +KQ  +
Sbjct: 331 LLNAPVFISAGSPSLPTKAVKQLIL 355


>SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1375

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 4/79 (5%)
 Frame = +3

Query: 276  NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADV----QVILLSATMPDDVLEVSRCFMR 443
            ++I+  VLDEAD ML  GF+ QI  +    S       Q ++ SAT P ++  ++R F+ 
Sbjct: 998  DSIRFLVLDEADRMLDMGFEPQIRRIVDQDSMPKTGIRQTLMFSATFPKEIQMLARDFLE 1057

Query: 444  DPVRILVQKEELTLEGIKQ 500
            + + + V K   T E I Q
Sbjct: 1058 NYIFLAVGKVGSTSENITQ 1076



 Score = 37.5 bits (83), Expect = 0.012
 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 2/37 (5%)
 Frame = +1

Query: 151  CHACI--GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            C  C+  GG ++   +R+L+   H++V TPGR+ DM+
Sbjct: 954  CRPCVVYGGADIGSQLRELDRNCHLLVATPGRLVDMM 990


>SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36)
          Length = 428

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 9/68 (13%)
 Frame = +1

Query: 1   GKTATFSISILQQI---------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F+I +L  I         + + +   ALILAPTRELAQQI++ ++  G  L  + 
Sbjct: 150 GKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRPLGIRT 209

Query: 154 HACIGGTN 177
            + IGG +
Sbjct: 210 VSVIGGAD 217


>SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31)
          Length = 978

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 23/62 (37%), Positives = 32/62 (51%)
 Frame = +1

Query: 52  IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGT 231
           ++  +A I+ P RELA QI K   +L  H   +    IGG   +     LES V ++V T
Sbjct: 453 LKRPRACIVVPARELATQILKTAKSLCHHARFRSVGLIGGRKQKWMRDDLESPVDLLVAT 512

Query: 232 PG 237
           PG
Sbjct: 513 PG 514


>SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 268

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 16/46 (34%), Positives = 26/46 (56%)
 Frame = +3

Query: 327 GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           GF+ +I  +   +  D Q ++ SAT P  V  ++  +M DPVR+ V
Sbjct: 2   GFEPEIKKILLDIRPDRQTVMTSATWPPGVQRMADQYMTDPVRVFV 47


>SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27)
          Length = 559

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 25/89 (28%), Positives = 47/89 (52%), Gaps = 4/89 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELA-QQIQKVVIALGDHLNAKCHACIGGTN 177
           GK+  F   +L  +    R    +I+ PTRELA Q + +V   LGD   +   + + G +
Sbjct: 209 GKSLVF---LLPSVQDPGRGYGTIIVVPTRELASQMLYEVSRLLGD--KSIVASFVSGVD 263

Query: 178 VREDIRQLESGVH---VVVGTPGRVYDMI 255
           +    + L+  +H   +V+GTP R+++++
Sbjct: 264 LSRQEKLLKDSLHPPRIVIGTPKRLWEIV 292


>SB_54977| Best HMM Match : MFS_1 (HMM E-Value=0.006)
          Length = 698

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = +1

Query: 313 KCCPEVSRTRSMMSSRFCQLMFKSYYSLLPCLMMYWKYL 429
           KCCP V+RT  ++   F    F ++ SLLP L +Y+K L
Sbjct: 398 KCCPSVNRT-LLVPKGFYFFFFSAWGSLLPYLALYFKQL 435


>SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27)
          Length = 331

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 19/52 (36%), Positives = 30/52 (57%)
 Frame = +3

Query: 327 GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKEELT 482
           GF+  I+ +   L    +  L SAT  D+V  + R  +R+PVR+ V +E+LT
Sbjct: 2   GFEASINTILGYLPKQRRTGLFSATQTDEVEALVRAGLRNPVRVTV-REKLT 52


>SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22)
          Length = 1058

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 18/70 (25%), Positives = 39/70 (55%), Gaps = 4/70 (5%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSR---GFKDQIHDVFKILS-ADVQVILLSATMPDDVLEVSRC 434
           +  + ++  +LDEAD++      GF++QI  +++  +  D+   L SAT+ + + E +  
Sbjct: 278 IELHNVEWLILDEADKLFEEGKDGFREQIATIYQACNKPDIHRGLFSATLSNGIEEWAGL 337

Query: 435 FMRDPVRILV 464
            + + VR+ V
Sbjct: 338 HLDNHVRVTV 347


>SB_4002| Best HMM Match : Galactosyl_T (HMM E-Value=3.1e-24)
          Length = 683

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = -1

Query: 270 EAHDEYHIIYTTWSAHHHMNTTLQLANIFTD 178
           ++H    II  TW+ + H NTTL+ A  F D
Sbjct: 103 KSHGRREIIRQTWTRNKHQNTTLEGAKHFYD 133


>SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057)
          Length = 96

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 3/38 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQI---DTSIRECQALILAPTRELAQQ 105
           GKTA F + IL+++    T     + L++ PTRELA Q
Sbjct: 59  GKTAAFMLPILERLLYRPTQSPAIRVLVITPTRELAIQ 96


>SB_9272| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 664

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 493 LNNFTCIELEEWKLETLCDLYDTLSIAQAVIFCN 594
           L N +C+ L+    +    LYD LS+A  +I CN
Sbjct: 255 LKNLSCLPLDRAAEQFASRLYDNLSVAAGLIECN 288


>SB_58206| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 675

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 3/77 (3%)
 Frame = +3

Query: 273 ANTIKLFVLDEADEMLSRGFKDQIHDVFK---ILSADVQVILLSATMPDDVLEVSRCFMR 443
           A  + +  +DE +E++S G   Q+   F+   I +A+ +   LS       +  +R   +
Sbjct: 174 AEAVHVGEVDELEEVVSTGIAVQLRTQFQKGDISNAEKREKRLSYNPEKGTINETRSIFK 233

Query: 444 DPVRILVQKEELTLEGI 494
           DP  + VQKE+  ++ +
Sbjct: 234 DPPHLPVQKEQNDVDNL 250


>SB_43842| Best HMM Match : RNB (HMM E-Value=0)
          Length = 1238

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%)
 Frame = +1

Query: 148 KCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRF-MPTPSNFL 294
           K  A  GG  V      L  G  VVV TPGR+ D+  +    M  P   L
Sbjct: 197 KAVAVCGGVPVSTQTIALREGADVVVATPGRLLDLYKITYLVMDEPDRML 246


>SB_25218| Best HMM Match : zf-AD (HMM E-Value=0.094)
          Length = 436

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = -2

Query: 503 KLFNTFQGKLFLLYKYAYRISHKASRYFQYIIRHG 399
           +L  T  GK FLL  Y YR S K + +F +  R G
Sbjct: 387 RLMETQSGKHFLLIVYIYRESRKVTVHFGHDYRKG 421


>SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17)
          Length = 635

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVF 356
           T   +  + +K F+LDEAD +L++G  D I  ++
Sbjct: 151 TTDKISLHQVKFFILDEADGLLAQGNNDLIMKIY 184


>SB_2863| Best HMM Match : Asp (HMM E-Value=1.2e-07)
          Length = 721

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 3/32 (9%)
 Frame = -3

Query: 256 VSYHIHDLECPP---PHEHHSPVGEYLHGHWC 170
           ++Y  H+  CP    PHEH  P+    H H C
Sbjct: 663 MNYLSHEHMCPMNNVPHEHMGPINNVSHEHMC 694


>SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 512

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 16/43 (37%), Positives = 25/43 (58%)
 Frame = +1

Query: 37  QIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           Q D++++E    IL    ELA++IQK++      LN K  AC+
Sbjct: 58  QGDSTLKEPVQKILIIGLELAKEIQKLIDEASSGLNIKHAACL 100


>SB_15811| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 248

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = -1

Query: 153 AFSIQVITKSYHHLLNLLGQLSCGSQDQSLTFTNACID 40
           A ++Q +TK+Y HL+N+ G      +++    T  C D
Sbjct: 201 AHALQTLTKAYRHLMNVTGN---RDKEEKANATEQCAD 235


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,463,197
Number of Sequences: 59808
Number of extensions: 607189
Number of successful extensions: 2254
Number of sequences better than 10.0: 45
Number of HSP's better than 10.0 without gapping: 2061
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2232
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2072022557
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).